KEGG   Danio rerio (zebrafish): 569294
Entry
569294            CDS       T01004                                 

Gene name
rcor1
Definition
(RefSeq) REST corepressor 1
  KO
K11829  REST corepressor 1
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Myb_DNA-binding ELM2 Myb_DNA-bind_7 Myb_DNA-bind_6 Homeobox_KN
Other DBs
NCBI-GeneID: 569294
NCBI-ProteinID: NP_001073510
ZFIN: ZDB-GENE-050506-79
Ensembl: ENSDARG00000031434
Vega: OTTDARG00000009861
UniProt: A1L228
Position
17
AA seq 458 aa
MPAMLEKGTTEISGKRRGRNSVNNPTKSFTSNGNSNNSWEEGSSGSSSDDEHGAGGMRVG
PQYQAVVPDYDPEVAKASHERENLGMLVWIPKTSIPEAKLDEYIAIAKEKHGYNMEQALG
MLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQGFSFHGKTFHRIQQMLPDKSIASL
VRFYYSWKKTRSKTSVMDRHARKQKREREESDEEEENGSTSPGDTELEPNKEEKKEGTSG
TEKQESKPAVVQKPAILAEKPMHVKKEAQGLAGRNLNRAKKKPPKGMYLSADDVTAMSSS
GPAAVSVLRGLDMELIAIKRQIQSIKQHNSALREKLDTGVDEFRPSESNQKFNTRWTTEE
QLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNLDEVLQEWEAEHGVEERK
GLDEEKMEVSSEDGTTSGPAENQTEEQTPMETQNPSVS
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgcccgcaatgttagagaagggcaccaccgagatttcgggtaaaaggaggggcaggaac
tctgtaaataatccgaccaaaagttttacttcaaacgggaacagtaacaattcatgggag
gaaggaagttcgggttcctcaagtgatgacgagcatggtgcgggcgggatgagagttgga
ccgcagtatcaggcagttgttcccgattatgaccccgaagtagcaaaggcgagccatgag
agggagaatctgggaatgctggtgtggattcccaaaacaagtattccagaggccaaattg
gatgaatatattgcaatagccaaagaaaaacatgggtacaatatggagcaggcattgggc
atgctgttttggcacaaacacaacattgaaaaatctttggcagatctccccaacttcacc
ccttttccagacgagtggacagttgaagacaaggtgctgtttgaacagggtttcagtttt
catggaaagacgtttcaccgcatccagcagatgcttccagacaagtcaattgcaagcctg
gttaggttttattactcatggaagaaaactcggagcaaaacgagcgtgatggaccgccat
gcacgcaaacaaaagagagagcgagaagaaagtgatgaagaagaagaaaatggtagcacc
tctccaggggatacagaattggagcctaataaggaagagaaaaaagagggaacttctgga
accgagaaacaagaatcaaaacctgcagttgtgcaaaagccagcaattcttgcagagaag
ccaatgcatgtaaagaaggaagcccagggtcttgcagggaggaacctgaacagggctaag
aaaaaacctcccaagggaatgtatttaagtgctgatgatgtgactgcaatgtccagcagt
ggcccggctgcagttagtgtgctgagagggctggatatggagctcattgccataaaacgt
cagattcagagcattaaacagcacaatagtgctctcagagaaaagctggacactggtgtg
gatgagttcaggccatctgagtcgaaccagaaatttaatacccgctggaccacagaagag
cagctgcttgcagtgcaagctataaggaagtacgggcgggatttccaggccatttctgat
gtgatcggcaacaagtctgtggtgcaagtcaaaaacttttttgtgaattaccggcgtcgc
ttcaacctggacgaggtgctgcaggagtgggaagcagagcacggtgtggaggaacgcaag
ggtttagatgaagagaagatggaggtgtcatctgaagacggcacaacctcagggcctgca
gaaaaccaaacagaggaacaaacgccaatggaaacacagaacccttcggtttcctga

DBGET integrated database retrieval system