KEGG   Danio rerio (zebrafish): 569382
Entry
569382            CDS       T01004                                 

Gene name
trhrb
Definition
(RefSeq) thyrotropin-releasing hormone receptor b
  KO
K04282  thyrotropin-releasing hormone receptor
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04020  Calcium signaling pathway
dre04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    569382 (trhrb)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    569382 (trhrb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    569382 (trhrb)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Peptide
   Thyrotropin-releasing hormone (TRH)
    569382 (trhrb)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw 7tm_4 UCR_TM
Other DBs
NCBI-GeneID: 569382
NCBI-ProteinID: NP_001108160
ZFIN: ZDB-GENE-060503-382
Ensembl: ENSDARG00000036159
Vega: OTTDARG00000014302
UniProt: A8E7L5
Position
19
AA seq 399 aa
MENFTVFNETLETWTDRSVEYKAISVLIVFLICALGIVGNVMVILVVLTTKHMRTPTNGY
LVSLAVADLMVLVAAGLPSIADSLFGSWVFGHAGCLCITYFQYLGINASSCSITAFTIER
YIAICHPIKAQFLCTLSRAKKIIIGVWVFTSLYCVMWFYLSDVQQVLYKDATIITCAYKV
SRNLYLPIYFFDFGIFFVLPLTLATVLYGLIARILFLNPLPSDTKEEKNGHGNFSKAKRN
KLKSSSRCSSTTAASRRQVTKMLAVVVILFAVLWMPYRTLVVVNSFLQDAYLDTWFLLFC
RTCVYLNSAINPLIYNAMSQKFRAAFRRLCRCGRNAQANKAAYSVALTYSVAKETSTVES
TGHFSTEIDDLTPTDELFPDKKLLYSEDCDFRKETFSQA
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggagaacttcacagtgtttaacgagactctggaaacttggactgaccgcagcgttgaa
tataaggcgatcagcgttctcatagtgttcctcatatgcgccctcgggatagttggaaat
gtgatggtcatcttggtggtcctcaccacgaaacatatgcggaccccgaccaatggctat
ctggttagtttggctgtcgcagacctgatggtgttggtcgcagccggtctgcccagcata
gcggacagcttgttcggatcatgggtatttgggcacgcggggtgcctgtgcatcacatac
tttcaatatctaggaatcaacgcatcctcgtgctccataacagcgttcactatagagcga
tacatcgctatatgtcacccaatcaaagcgcagtttttatgcacactctcgcgcgccaag
aagatcattattggagtttgggttttcacttcgctttactgcgtaatgtggttttacctg
tccgacgtccaacaggtgctctataaggatgcgactataataacgtgcgcttacaaagtg
tctagaaacctttacctacccatctattttttcgactttggcatcttttttgttctgccc
ctcactcttgccactgtcctctacggcctcattgcgagaattttgtttctaaatcctctc
ccgtcggacacaaaggaggaaaagaacggacatggcaacttctccaaagccaaaaggaac
aagctgaagagttccagccgctgctccagtacaactgcagcatccagaagacaggttaca
aagatgctggcagtggtggtgattctgtttgctgtgttgtggatgccatatcgcaccctg
gtggtggtcaactccttcctccaggacgcttacctggatacctggtttctgctgttctgt
cgcacatgtgtctacctcaacagtgccatcaaccctctgatctacaacgccatgtctcag
aagttccgcgctgccttcaggaggctctgccgctgcgggcgcaatgctcaggccaataag
gcagcctatagtgtggcattaacctacagtgttgccaaggaaacatcaacggtggaaagc
acagggcatttttcaactgagatagacgatttgactccaacagacgagctgtttcctgat
aagaagcttctgtactcggaagactgtgactttaggaaggagactttcagtcaggcttga

DBGET integrated database retrieval system