KEGG   Danio rerio (zebrafish): 569420
Entry
569420            CDS       T01004                                 

Symbol
wnt3
Name
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04150  mTOR signaling pathway
dre04310  Wnt signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    569420 (wnt3)
   04150 mTOR signaling pathway
    569420 (wnt3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    569420 (wnt3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    569420 (wnt3)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Heparin
  Morphogens
   569420 (wnt3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 569420
NCBI-ProteinID: NP_001108024
ZFIN: ZDB-GENE-081003-1
Ensembl: ENSDARG00000038990
Vega: OTTDARG00000035654
UniProt: B0LK22
Position
12
AA seq 355 aa
MDLYLVGFLMCMWFSSSRVLGGYPIWWSLALGQQYSSIGSQPILCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIKDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTMCGCDSHHKGPPGEGWKWGGCSEDAEFGVLVSREFADARENRP
DARSAMNRHNNEAGRMTILENMHLRCKCHGLSGSCEVKTCWWAQPDFRLLGDYLKDKYDS
ASEMVVEKHRESRGWVETLRAKYAFFKHPTERDLVYYEGSPNFCEPNPETGSFGTRDRAC
NVSSHGIEGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECVRVYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggatttgtacctggttggatttctcatgtgcatgtggttctccagctctcgggtgctt
ggaggctatcccatctggtggtccctggcccttgggcagcagtactcatccattggatcc
caacccatcctgtgtggctccatacctggcctggtgccaaaacagctgcgcttctgccgc
aattacatagagatcatgcccagtgtagcggaaggagtcaaactgggtatccaggagtgt
cagcaccagttccgtggtcgcaggtggaactgcaccactatcaaggacagtctagcaata
tttggaccagtgcttgataaagctacaagggaatctgcatttgttcatgcgattgcctca
gctggagtagcatttgcagtaacccgttcatgtgcagaggggacctccactatgtgtggc
tgtgactcccatcataaaggcccaccgggagaaggatggaagtggggtggctgcagtgaa
gatgctgaatttggggttttggtatctcgagagtttgcagacgctcgtgagaaccggcca
gatgctcggagtgccatgaacaggcacaacaatgaggcaggacgaatgaccatattggag
aacatgcacctgcgctgtaaatgccatgggctgtcaggcagctgtgaagtgaagacgtgc
tggtgggcgcagcctgacttcagactgttgggggactacctgaaagacaagtacgacagc
gcctctgagatggtggtggagaaacaccgggagtccagaggctgggtggaaacactacga
gccaaatacgccttcttcaagcatcccactgagcgagacctggtatactatgagggatca
cccaacttctgcgagccaaacccagagacgggctcattcggcacccgtgaccgtgcctgc
aacgtgtcgtcgcacggcatcgaaggctgtgacctgctgtgctgtggccgtggccataac
acacggacagaaaagcgcaaagagaaatgccactgcatcttccactggtgctgttacgtt
agctgccaggaatgtgtgagggtctacgacgtacatacatgtaaataa

DBGET integrated database retrieval system