KEGG   Danio rerio (zebrafish): 569755
Entry
569755            CDS       T01004                                 

Gene name
col6a1
Definition
(RefSeq) collagen alpha-1(VI) chain
  KO
K06238  collagen type VI alpha
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04510  Focal adhesion
dre04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    569755 (col6a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    569755 (col6a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    569755 (col6a1)
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    569755 (col6a1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   569755 (col6a1)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   569755 (col6a1)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   569755 (col6a1)
Motif
Pfam: VWA Collagen VWA_2 VWA_3 VWA_CoxE
Other DBs
NCBI-GeneID: 569755
NCBI-ProteinID: XP_009304444
ZFIN: ZDB-GENE-070501-6
Ensembl: ENSDARG00000074908
Vega: OTTDARG00000035781
UniProt: F1Q6P3
Position
11
AA seq 1007 aa
MALNGYILTALCALWAGIFAQDVSRSSFRECPVDLFFVLDTSESVALRAKPPEFYINQIK
TFTKLFIDELKDLRQPCDRDVTWNSGALHYSDDTELVMGLVDLNTKRADLKAAIDRIKYI
GKGTYTDCAIKEGIAELLRAGSHYHENKYIVVVTDGHPITGYKEPCGGIQEAANEARQHA
IKVFAVAISPDQEDTRLSVIATDINYRQNFTAADNSRSTQMSTIRSIIHMITNETKDVCC
SFDCIADGGPQGPPGDPGQRGETGRPGMPGEKGDFGAQGNPGDPGPVGYQGMKGDQGIKG
DKGERGHKGFKGDKGHHGLDGTDGRKGEPGFPGLPGCKGSPGPDGLQGESGPKGDPGQYG
RKGERGDPGRDGEPGRPGNYGPSGAKGDRGPRGANGDKGERGDDGPPGPDGPRGERGQGG
EKGEQGSRGNRGPRGEPGEPGPRGEQGREGSSGANGEPGEQGRAGQPGYRGDEGPAGPEG
DKGPRGIKGAPGDRGLMGERGEDGPPGNGTEGCAGFQGYPGPRGDPGAPGGKGTPGPKGD
DGEPGDTGLDNDRLGPPGTKGAKGHRGPEGKPGPPGPPGPQGADECEILDIIMKMCSCCE
CTCGPLDIAFIVDSSESIGASNFAISKEFIVTIMDRLKLRQFGANESRIGVVQYSGEKSQ
EVVQLGDPNIKTLTDLKQAVKDLRWLAEATYTGEALQYSLRNMLSKLITERSVVLVLTDG
RSDTIRDKVPLNVLCGKGFKVGGVGVTDYAERKPNPEQLDEVVCKDDPRKGFSFVLNNFG
LLLDDNFLQNLTEKICEDKKCPTYTCPISFNDNTDVLIMMDSSASVGAKNFEMTKDFSRM
LAKRFLSAERGNFQVRIGVGQYSNNANLEAEFSTNATQVVAQIADAKFQNAGTQVTNALN
FAIERFRGGRTRKKKLLVFSDGRSQGVNSIQIEKAVEQVSNAGIELYVLAVGNQVNEAHL
RTLVSRGRPYDNTYAYRHLFKVPDYRSLVTGVFYQTVSRKISLETRG
NT seq 3024 nt   +upstreamnt  +downstreamnt
atggcgcttaatggatatatattgaccgctctgtgcgctctttgggcagggatcttcgct
caggatgtctccagatcctccttcagagagtgtcctgtggacctgttctttgtgctggac
acgtctgaaagtgtggctctcagagccaaacctccagagttttacatcaaccagattaag
accttcacaaagctgttcatcgatgagctcaaagacctacgccagccctgtgatcgcgat
gtgacatggaactcgggagcgctgcactacagtgatgacacagagctggtcatgggatta
gtcgacctcaacacaaaacgtgctgaccttaaagctgccatcgacagaatcaaatacatc
ggcaagggaacgtacaccgactgcgccatcaaggagggcatcgctgagctgctcagagcg
ggttcgcattatcatgagaataaatacattgtggtggtgacggatggtcatcctataacc
ggatataaggaaccatgcggtggcattcaggaggccgccaatgaggctcgacaacatgcc
attaaagtgtttgctgtggccatctcacctgaccaggaggacaccagactgtctgtcatt
gccacagatataaactacagacagaacttcaccgctgcagacaactcccgctccacacaa
atgagcactatacgctccatcatccacatgattacaaacgaaacaaaggatgtgtgctgc
tcctttgactgcatcgctgatggaggccctcaaggaccccctggagatccaggtcaaagg
ggagagaccgggagaccaggcatgccaggagaaaaaggagactttggggctcagggaaat
cctggtgatcccggtccagtcggttaccaaggaatgaagggagaccagggaataaaaggt
gataagggagagagaggtcataaaggcttcaagggagacaaaggtcatcatggtctcgat
ggcacggatggacgtaagggcgagccgggattccctggacttccaggctgtaaagggtca
ccagggccagatggtttgcaaggagaatcagggcctaaaggagaccccggacaatatgga
cgcaaaggagaacgaggagatcctggcagagatggtgagccaggaagacctggaaactac
ggaccatctggggccaagggagacaggggtcctcgtggggctaacggcgataaaggcgag
agaggagatgatggaccaccaggaccagatggcccaagaggagaaagaggccaaggtggt
gagaagggtgaacaagggtctcgaggtaacagaggtcccagaggcgagcctggtgaaccc
gggccaaggggtgagcaaggacgtgaaggatcatccggagcaaatggagagccgggtgag
caaggaagagcagggcagccaggttatcgtggcgatgagggtcctgctgggccagaggga
gataaagggcccagaggaatcaaaggggctccaggagacagaggcctgatgggagagagg
ggtgaagacggacctccaggaaacgggacggagggttgtgctggctttcagggttatcct
ggtccaaggggagatcctggagcacctggtggaaaaggaaccccaggacccaagggagat
gatggagagccgggtgacactggattagataatgacagacttggaccacctgggacaaaa
ggagccaaaggtcacagaggacctgaaggaaaacctggacccccaggaccacccggacct
caaggagctgatgaatgtgagattctggatatcatcatgaagatgtgctcttgctgtgaa
tgcacatgtggacccttggatattgcctttatcgtggacagctctgagagtattggagct
tctaactttgccatctctaaagaattcatcgtgacaataatggacagactcaagttaaga
cagtttggtgccaatgagtctcgtattggtgtggtgcagtacagtggtgaaaaatctcaa
gaggtggtacagcttggtgaccccaacatcaagaccctgaccgacctaaaacaagctgtg
aaagacttgcgctggctggctgaggccacatacactggagaagctcttcagtactcgcta
agaaacatgctcagcaagcttatcacggagaggagtgtggtccttgttcttactgatgga
cgctcagacactattagggataaagtgccattaaacgtgctgtgcggcaaaggatttaag
gttggtggggttggagtgacggattacgcagagaggaaacccaatccggaacagcttgat
gaggttgtgtgtaaagatgatcctagaaaaggcttctcctttgtcctaaacaactttggc
ctacttctggatgacaacttcctgcaaaacctgactgagaaaatctgtgaagataagaag
tgtcccacatatacttgtccaatttcatttaatgacaacaccgatgtcctcatcatgatg
gacagctcggccagcgttggcgccaagaacttcgagatgaccaaggacttctcacggatg
ctagctaagcgctttttgtcagcagaaagaggaaatttccaggttcgaattggtgttggc
caatacagcaacaatgccaacttggaggccgaattttccacaaacgccactcaggtggtc
gctcaaatcgcagacgccaagttccagaatgcaggtacacaggtaacaaacgctctcaac
ttcgccatcgagcgcttcagaggcggtaggacgaggaagaagaagctgctggtgttttct
gatggtcgttctcaaggtgttaactccattcagattgagaaagccgtggagcaggtgagc
aacgcaggaattgagctgtatgttcttgctgttggaaatcaggtgaatgaagcgcattta
cgcaccttagtgagccgaggccggccttacgacaacacctacgcctaccgccatcttttc
aaagtacccgactaccgctcattggtcactggggtattttaccaaactgtgtcccgcaag
atttccctggagacgagagggtga

DBGET integrated database retrieval system