KEGG   Danio rerio (zebrafish): 570320
Entry
570320            CDS       T01004                                 

Gene name
ddhd1b
Definition
(RefSeq) phospholipase DDHD1b
  KO
K13619  phospholipase DDHD1 [EC:3.1.1.-]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    570320 (ddhd1b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     570320 (ddhd1b)
SSDB
Motif
Pfam: DDHD WWE
Other DBs
NCBI-GeneID: 570320
NCBI-ProteinID: NP_001025417
ZFIN: ZDB-GENE-040724-18
Ensembl: ENSDARG00000037042
Vega: OTTDARG00000004047
UniProt: Q5VSC8
Position
20
AA seq 859 aa
MSACQDKSSLSCSESRENVSGSEWGRMDDGCASCFNDPTGDAIHGGMDAVQPGITLDGHL
PLPPGQLMLGLVEEGFAGYHSHLGSDPDTDYLDIPGDPNYSESDGNVATKKRNRSNSSRH
RGEVVTELGPEEVRWFYKEDKRTWKPFVGHDSLKIELAYRKYCELNPEEVKRRDATEEAE
DLFESSSGCEEPAVRRQSAAVAAQPVPDSADAGCSADDSVFRSDSVNVDAVCVRGGLYEV
DIKGKSCYPVYWNQQDHIPVMRGQWFTDGTWLPLEEEDSDLIELEHLACFRGQQMKDTFD
TEAVATTVDSKDAIHSLKLSRSHVDWHSVDEVYLYSDATTSKIARTVTQKLGFSKASSSG
TRLHRGYVEEAALEDTPPETTHIVFVVHGIGQKMDQGRIIRNTSMMRDAARKMEEKHFSD
RINEHVEFLPVEWRSKLALDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRDEITR
GLTKELNRLYMLFCERNPEFAEKGKVSIVSHSLGCVITFDIMTGWDPVRFVHEDVPDVME
ADVSRQERQLLEELRLTYLRIRDLEDRLQNFQTSSSRPSPALKFKVENFFCMGSPLAVFL
ALRGVRPGSGGTQDHILPTSICQRLFNIFHPTDPVAYRLEPLILKHYSNITPVQIHWYNT
TSPTPYDQIRPTLLNPSKENASVSDTESLPSPCTSPPQPRRHYSESITNLGKASIMGAAS
IGKGIGGILFSRFSRSSGQVGGVEEETSDSEGGTCEKGDENRSVDLDDKPDEKTEEKIEE
KTGDTSMSQSASTIMDYSSLELEKRIDFELREGLVESRYWSAVTSHTAYWCSHDVALFLL
TFLYRPNEANDMAEDNLES
NT seq 2580 nt   +upstreamnt  +downstreamnt
atgagcgcttgtcaggacaaatcgtctttgagttgctcggaaagcagagaaaatgtcagc
ggtagtgaatggggaaggatggatgatggttgcgcgtcctgctttaacgaccccacgggc
gacgcgattcacggcgggatggacgcggtgcagccgggcataacattggacggacatctg
ccgcttcccccaggccagctgatgctaggcctggtggaggagggtttcgctggctatcat
agccatctcggctctgatccggacactgattatctcgacatccccggcgacccgaattac
agcgaaagtgacgggaacgtcgccacgaaaaagcgcaaccgctccaacagctcgcgccac
cgcggggaagttgtcacggaactcggacccgaggaggtgcgctggttttacaaggaggac
aagaggacctggaaaccgttcgttggccacgattccttaaaaatcgagctggcgtatcgt
aaatactgcgaacttaatccggaagaggtcaaacggagggatgcgacggaagaagcggag
gatttattcgagtcttcttcaggatgcgaggaaccggcggttcggaggcagtcggcggcg
gtggcagctcagccggtacccgacagcgcggatgcgggatgctcagcggacgattcggtg
ttcaggtcagacagcgtcaacgtggacgcagtgtgtgtgcgtggaggactctatgaggtg
gacatcaaaggaaagagctgctatcctgtgtactggaaccaacaggaccacatcccagtc
atgagaggccagtggttcacagacggcacctggttgcccttggaggaggaggacagtgac
cttattgaactggagcacttagcctgtttccggggccagcagatgaaggacacctttgac
acggaagcagtggccaccacagtggacagcaaagacgccattcacagtctgaaactgagc
cggagccacgtggactggcacagtgtggatgaagtgtacctttacagcgacgccaccacc
tctaagattgcacggacggtcactcagaagctgggattctcaaaagcctccagcagtggg
acgcgtctccaccggggttacgtagaggaggcggctctagaggacacgccccctgaaact
acacacatagtctttgtggtacatggaattggccaaaagatggatcaggggcgtatcatt
agaaatacaagcatgatgcgggatgctgcccgtaagatggaggagaagcacttctctgac
cgaattaatgaacatgtcgagttccttcctgtggaatggcggtctaaactcgccctcgat
ggagacactgtggactccattactccagacaaagtgcgaggtctgagagatatgctgaac
agcagcgcaatggacattatgtactacacaagccctttgtacagggatgagatcacccgg
ggtctgaccaaagagttgaaccgcctctacatgctcttttgcgagcgcaacccagaattt
gcagagaaaggaaaagtgtccatcgtctcgcactcgctcggctgtgtcatcaccttcgac
atcatgacaggctgggatcctgtccgctttgttcatgaagatgtgccagatgtgatggag
gctgatgtgagcagacaagagcgtcagttgcttgaagagcttcggctcacttacttaaga
ataagggatttggaagacaggcttcagaatttccaaacctcatcctcaagaccatctcca
gccctaaaattcaaggtggagaacttcttctgtatgggatctcctctggctgtgtttttg
gctttgcgaggggttcgtcctggaagcggcggaacacaggaccacattctgcccacatcc
atctgccagcggctattcaacatcttccatcccactgatcctgtagcatacaggttggag
cctctcattctgaagcattatagtaatataacacctgtccagattcactggtacaacacc
accagccccacaccgtatgaccagatccgtcccactctactgaatccatcaaaggaaaat
gcgtcagtgtcggatacggagagtctgccaagcccctgcacctctccacctcagcctcgc
agacactacagcgagtccatcaccaacctgggcaaggccagcataatgggagcggctagt
ataggcaaaggcattggcggtatcctgttctccaggttttctcgctccagtggacaggtc
ggtggtgtggaggaggagacgtcagactctgaaggcgggacgtgtgagaaaggagacgag
aacaggtctgtggatttagatgataaaccagacgagaagacagaggagaaaattgaggag
aagacgggagacaccagcatgtcacaatcagcctcgaccattatggattattcctccttg
gagctggagaagcgcattgactttgagctgcgggagggtctggtggagagccgctactgg
tcagcagtaacgtcacacacggcctactggtgctcgcacgacgtggctctgtttctgctg
acgttcttgtacaggccaaacgaagccaatgacatggcagaggacaatctcgaatcctaa

DBGET integrated database retrieval system