KEGG   Danio rerio (zebrafish): 571064
Entry
571064            CDS       T01004                                 

Gene name
si:dkey-162b23.4
Definition
(RefSeq) sodium/hydrogen exchanger 9B2
  KO
K23994  solute carrier family 9B (sodium/hydrogen exchanger), member 1/2
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    571064 (si:dkey-162b23.4)
Transporters [BR:dre02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   571064 (si:dkey-162b23.4)
SSDB
Motif
Pfam: Na_H_Exchanger CheY-binding
Other DBs
NCBI-GeneID: 571064
NCBI-ProteinID: XP_005160140
ZFIN: ZDB-GENE-110411-203
Ensembl: ENSDARG00000052700
Vega: OTTDARG00000034299
UniProt: E7FBR3
Position
1
AA seq 564 aa
MEQKCSAMEDVQSRPHSAHSLYSQRTEDATSALGNHAEHHLTVSQTVLVVPKRPESPNPS
MTEETIYVPRPVSAVDACTNTDPPYECCPWLRRLCPCPPRGMLAAIITKVTMAAVLFGVV
WSITEKECLPGGNLFGIVTLFICSVAGGKLFGRIRLPRLPPVPPLLGMLLAGFILRNIPV
VTDAVYIDVRWSSSLRNIALGVILVKAGLELDSKALKKLKAVCLRLSMFPLIFEAATMAV
MSYLILGLPWIWGFILGFVLGAVTPAVVVPSMLLLHRQGYGLEQGIPTLLMAACSVDDII
AITCFTTCLGIAFATGSVWLNVLRGPLEVLGGAVTGVALGFFLHYFPSRDQRNLVLKRSF
LVLGLSVFALFGSNVAGIPGAGGLCTLVLAFVAGIGWGRAKASVEAVVERFWLVFQPLLF
GLIGAEIVISSLELTTVFLGIAALFIGLTVRLLVTFIVVLRAGFNLKEKIFVTLAWMPKA
TVQAAIGSTALDMARSKQDLELQKYGMDVLTVAVLSIIITAPIGALLISLLGPRLLQKPK
NPEWAVSQGALSASGTPVTYESAL
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggagcagaagtgcagtgccatggaggatgtccagtccagaccacattcagcccactcc
ctttactcgcagcggactgaggatgccacctctgcgttggggaatcatgctgaacaccac
ctcactgtcagtcagacagtcctggtggttccaaagcgtccagagagtcccaatcccagt
atgacagaagagaccatctatgtccctcgaccagtgtcggcggttgatgcttgcaccaac
acagaccctccgtatgaatgctgcccatggctgcgcagactatgcccgtgtccacccaga
ggcatgctggctgccattatcaccaaagtgaccatggccgcagtgctctttggagtggtc
tggtccatcacagagaaggaatgtcttccaggcgggaaccttttcggaattgtgaccttg
tttatttgttcagtggccggaggaaaactgtttggacgcatacgtttaccaagactgcca
cctgtacctcctctgctcggcatgctgctggcaggctttatcctcagaaacatccctgtg
gttacagatgcggtgtacattgatgttagatggtcctcttctctgaggaacatcgctctt
ggtgtcattctggtaaaggctggcttggaattagacagcaaggcactgaagaagctgaaa
gctgtgtgtttgcgtttgtccatgttccctctcatttttgaggcagccaccatggcggtg
atgtcctatttaatacttggtcttccatggatctggggctttattttagggtttgttctt
ggggctgttactccagctgttgtggttccatccatgctgcttctacataggcaaggatac
ggtttagagcagggtatacctacacttctcatggcagcgtgcagcgttgatgacatcatt
gccattacctgctttaccacctgcttgggcattgctttcgccacaggctccgtgtggtta
aacgtgctgcggggtccgctggaggtattgggtggtgcagtcactggtgtggcattaggg
ttctttttacattacttccccagcagagaccagagaaacctcgtgttgaaacgctccttc
ctggtgttgggcttgtcagtgtttgctctgtttggcagtaatgtggctgggattcctgga
gcaggcggtctctgtacactggtgctggcgtttgtggccggaataggctggggaagagct
aaggcttcagtggaagcagtagtggagaggttttggcttgtgtttcagcctcttctcttt
ggactcatcggtgctgagattgttattagttctttggagctcacgactgtgtttttgggt
atagcagctttgttcatcggcctcaccgtacgcctgcttgtcactttcattgtggtcctg
cgagccggatttaacctgaaagagaagatctttgtcactctcgcctggatgcctaaagcc
acagtacaggcagctataggctctacagctttagacatggcccgttccaagcaggacctg
gagctgcagaagtacggcatggacgtcctgactgtggctgtgctgtcaatcatcatcact
gctcctattggagctctgctcatcagcctgctcggccctcgactactgcagaaaccaaag
aaccctgagtgggctgtcagtcagggtgcgttgtctgcctcagggacaccggtgacgtat
gaaagcgcgctctga

DBGET integrated database retrieval system