KEGG   Danio rerio (zebrafish): 571753Help
Entry
571753            CDS       T01004                                 

Gene name
ppp1cc
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03015  mRNA surveillance pathway
dre04114  Oocyte meiosis
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    571753 (ppp1cc)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    571753 (ppp1cc)
   04218 Cellular senescence
    571753 (ppp1cc)
  Cellular community - eukaryotes
   04510 Focal adhesion
    571753 (ppp1cc)
  Cell motility
   04810 Regulation of actin cytoskeleton
    571753 (ppp1cc)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    571753 (ppp1cc)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    571753 (ppp1cc)
   04270 Vascular smooth muscle contraction
    571753 (ppp1cc)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    571753 (ppp1cc)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     571753 (ppp1cc)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     571753 (ppp1cc)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     571753 (ppp1cc)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     571753 (ppp1cc)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    571753 (ppp1cc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 571753
NCBI-ProteinID: XP_700468
ZFIN: ZDB-GENE-030131-5877
Ensembl: ENSDARG00000099226
UniProt: A0A0R4IZT6
Position
5
AA seq 323 aa AA seqDB search
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECRRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNPSRPVTPPRNMVTKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatcgacaaactcaacatagacagcatcattcagcgcctgctcgaggtgaga
gggtcgaagcctggtaagaacgttcagctgcaggagaacgagattcgaggattgtgttta
aagtctcgtgagattttcctcagtcagcccatcctgctggagctcgaagcgccgctcaag
atctgcggtgacatccacggtcagtactatgacctgctccggctcttcgagtatggagga
tacccacctgagagtaattacctgttcctgggagattatgttgaccgagggaagcagtct
ctggagaccatctgtctgctgctggcctacaagatcaaatacccggagaacttctttctg
ctgagggggaatcacgagtgcgcctccatcaaccgcatctacggcttctacgacgaatgc
aggagacgctacaacatcaagctctggaagacttttacagactgcttcaactgtctgccg
atcgccgccatcgtggacgagaagatcttctgctgtcacggaggtttgtctccagatctg
cagtctatggagcagatcagacggatcatgcggcccacagacgtgccggatcagggtctg
ctgtgtgacctgctgtggtcagaccctgataaagatgtgttgggctggggagagaacgac
agaggagtctcctttacattcggagctgaagtagtggcaaaattcctgcacaaacatgac
ctggatttgatctgcagagcccaccaggtggttgaggacggatatgagtttttcgccaag
cgtcagctggtcactctgttttctgcacccaattactgtggagaattcgacaacgctgga
gccatgatgagcgtggacgagaccctcatgtgctctttccagatcctgaaacctgcagag
aagaagaagccaaaccccagccgtccagtgactccaccgagaaacatggtcaccaagcag
gccaagaaatga

DBGET integrated database retrieval system