KEGG   Danio rerio (zebrafish): 571834Help
Entry
571834            CDS       T01004                                 

Gene name
si:dkey-28b4.7
Definition
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre00240  Pyrimidine metabolism
dre01100  Metabolic pathways
dre03030  DNA replication
dre03410  Base excision repair
dre03420  Nucleotide excision repair
dre03430  Mismatch repair
dre03440  Homologous recombination
Module
dre_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    571834 (si:dkey-28b4.7)
   00240 Pyrimidine metabolism
    571834 (si:dkey-28b4.7)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    571834 (si:dkey-28b4.7)
   03410 Base excision repair
    571834 (si:dkey-28b4.7)
   03420 Nucleotide excision repair
    571834 (si:dkey-28b4.7)
   03430 Mismatch repair
    571834 (si:dkey-28b4.7)
   03440 Homologous recombination
    571834 (si:dkey-28b4.7)
DNA replication proteins [BR:dre03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    571834 (si:dkey-28b4.7)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      571834 (si:dkey-28b4.7)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     571834 (si:dkey-28b4.7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 571834
NCBI-ProteinID: NP_001243129
ZFIN: ZDB-GENE-050506-118
Ensembl: ENSDARG00000079632
Vega: OTTDARG00000030053
UniProt: F1R563
Position
1
AA seq 117 aa AA seqDB search
MTISYQRPDMTPKRGLITDTFKVVKKARRGGKRSKSPSPPKAEPEPPQLSEREKDIQELK
NFDLDWKFGPCTGISRLQRWERAALHGLNPPQEIKDILLKEDTDPEYTQSLWRDYPF
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgacgatatcctatcagcgtccagatatgacaccaaagcgtggcctcatcaccgacacc
tttaaggttgtgaagaaggcaaggagaggaggcaagagaagcaagtctccttcaccaccg
aaagcagagcctgaacccccacaactgagtgaaagagaaaaagatatacaggagctgaag
aactttgatctggattggaagtttggaccatgcacagggatcagtcgactgcagagatgg
gagagggcagcactgcatgggctgaatcccccgcaggagattaaagacattttgctgaag
gaggacactgacccagagtacacacagagtctctggcgtgactatcctttctga

DBGET integrated database retrieval system