KEGG   Danio rerio (zebrafish): 572070Help
Entry
572070            CDS       T01004                                 

Gene name
si:ch73-170l17.1
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 isoform X2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00760  Nicotinate and nicotinamide metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    572070 (si:ch73-170l17.1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     572070 (si:ch73-170l17.1)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     572070 (si:ch73-170l17.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 572070
NCBI-ProteinID: XP_021323500
ZFIN: ZDB-GENE-070912-331
Ensembl: ENSDARG00000077034
Vega: OTTDARG00000025108
Position
2
AA seq 183 aa AA seqDB search
MARLALQSSDWVSVDDWESQQPDWTETVVTMRYHYGRVAAQHCCNKGPPTTSDVPQLKLL
CGADFMDSFKVPGLWTDEHIEEVVGRFGLVCVSRGSLQPDRAIHESDLLSKHRPSIFLVR
EWVHNEISATEIRRALRRGHSVKYLLPDSVIEYIREHKLYTQDSEMKNKDVKLRPLTKQV
ILD
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcaagactggccttgcagagctccgactgggtttctgtagatgattgggaaagccag
cagccagattggactgaaactgtggtgaccatgaggtaccactacggccgtgtagctgct
caacactgctgtaataagggaccgcccacaacctcagatgttcctcagttgaagctgttg
tgtggagctgatttcatggactcctttaaagtgcctggtctgtggacggatgagcacatc
gaggaggttgtgggccgatttggactggtctgcgtgagccgtggcagccttcagcctgat
cgtgctatacatgagtctgatttgttgtccaagcaccggccaagcattttcctggttcgg
gagtgggttcacaatgagatcagcgccacggagatccgtcgagctctgaggagaggtcac
agtgttaaatatctgttgccagactcggtcattgagtacataagagagcacaagctttat
acccaagacagcgagatgaaaaacaaagacgttaaactacgacctctcactaagcaagtg
atactagactga

DBGET integrated database retrieval system