KEGG   Danio rerio (zebrafish): 57925
Entry
57925             CDS       T01004                                 

Gene name
cdc25b
Definition
(RefSeq) M-phase inducer phosphatase 2
  KO
K05866  M-phase inducer phosphatase 2 [EC:3.1.3.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04110  Cell cycle
dre04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    57925 (cdc25b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    57925 (cdc25b)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    57925 (cdc25b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    57925 (cdc25b)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dre03400]
    57925 (cdc25b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     57925 (cdc25b)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    57925 (cdc25b)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    57925 (cdc25b)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese RsgA_N
Other DBs
NCBI-GeneID: 57925
NCBI-ProteinID: NP_001108567
ZFIN: ZDB-GENE-000330-5
Ensembl: ENSDARG00000010792
Vega: OTTDARG00000027744
UniProt: B8A5N7 B5LY73
Position
13
AA seq 563 aa
MDIDMVPGDVSPVYDPFSTGPESALGAPRFTLPELGARGSPCMKSLASPGPMAVLSPVTN
LALNMNNLAVLGGQCETPKRKKNLPLLKIPSFASDASSDAGLGLECPSPLDSLDAEQKFE
KAMQDATRAVNEKMPIRRIHSLPLQFLGHSPNLRSKELDPSRYGVWTHSHDSANKENMAE
ENFEFKKPSMPALRCRTRSTGGSKDAFACRPNSAPALMLSPPPTNQPDSPNEISPFILRR
PSLSCLQDDDDDDGFLEGLDDVENDSEVPLGMDSLLTAPLVAKQIPETDSPVIRCRPRGL
FRSPSMPCAVGRIPLKRPERPQDENTPVRVKRRRSLAGTQVSTTEQEDVVHQVQRSKSFN
HSQIERMLDTDPSNVIGDFTKAPALPTVQGKHQELKYITPEIMVKAMSGQFQDLVERLFV
IDCRYPYEYEGGHIKGALNLHQEDQIEDYFLRSPILPDCPKKRVLLIFHCEFSSERGPRM
CRYVRERDRFVNEYPNLHYPELYILKGGYKEFFQIHKAICEPQMYRPMLHEEFKEDLRKF
RLKSRTWAGERSKRDMYSRLKKL
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggatattgatatggttccaggcgacgttagccctgtttatgatccattcagcactggg
cccgaatcagccctcggagctccccgcttcactctgccggagctcggtgctcggggctcc
ccctgcatgaagagcctggcctctcccgggcccatggcggtgctgtctcctgtcaccaac
ctggccctcaacatgaataatctcgctgttcttggaggtcaatgtgaaactccaaagcgg
aagaaaaatttgcccctcctgaagattccttccttcgcctctgatgcctcttctgatgca
ggtcttggactagagtgtcccagtcctttagattctctggatgctgagcagaagtttgag
aaggccatgcaggacgccacacgagccgttaatgaaaaaatgcccatccgcaggatacac
tctttgccactccaatttttgggtcacagtccaaatctgaggagtaaagaattggatccc
tcccgttatggagtgtggactcattcacatgacagtgccaataaagaaaacatggctgag
gagaactttgagttcaaaaagccctccatgcctgcactgcgctgtcgcactcgctccacc
ggaggctccaaggatgcttttgcctgccgaccgaactctgctcctgctttaatgctctcc
ccaccacccaccaatcagccagactctccaaatgaaatcagtcccttcattctgcgccgt
ccgtcgctctcctgccttcaagatgatgatgacgatgatggctttctggaggggcttgat
gatgtggagaatgactctgaggttcctctgggaatggacagtcttctaactgctcctctg
gtggccaagcaaattcctgaaactgattcgcctgtcattcgctgtcgtccacgtgggttg
ttcagatctccatctatgccctgtgcagtcgggcgcatcccgctcaaaagacctgaaaga
ccacaagatgagaacacgcctgtccgagtgaagaggagacggagtctggcagggacacaa
gtgtcaaccacagagcaggaggatgttgtacatcaggttcagaggtccaagtcctttaat
cactcacagattgaaagaatgttggacaccgatcctagtaatgtgattggagattttacc
aaggctcctgcactgcccacagtacaaggaaaacaccaagagttgaagtacatcactcca
gagattatggttaaagcaatgagtggacagtttcaagatctagtggagaggctgtttgtt
atcgactgccgttatccgtatgagtatgaaggcggccatattaaaggtgctcttaatctc
caccaagaggatcaaatcgaagactactttttacgcagtcctattctccctgactgcccc
aagaagcgcgtcctgctgatttttcactgtgaattttcttcagagcgtggtccacggatg
tgtcgctacgttagagaaagagatcgatttgtgaatgaataccccaacctccattacccc
gaactctatatcctgaaaggaggctacaaagaatttttccagattcacaaagcaatatgt
gagccccagatgtatagaccgatgcttcatgaagagtttaaagaagacctgagaaagttt
cgtctgaagagccgcacctgggccggagaacgcagcaagagagacatgtacagccgtctc
aaaaaactctga

DBGET integrated database retrieval system