KEGG   Danio rerio (zebrafish): 57931
Entry
57931             CDS       T01004                                 

Gene name
axin1
Definition
(RefSeq) axin-1
  KO
K02157  axin 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    57931 (axin1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    57931 (axin1)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     57931 (axin1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 57931
NCBI-ProteinID: NP_571578
ZFIN: ZDB-GENE-000403-1
Ensembl: ENSDARG00000102964
Vega: OTTDARG00000035203
UniProt: P57094
Position
3
AA seq 835 aa
MSMSVNEKGICYLPDLGSSFTEDAPRPPVPGEEGDLVSSDGRQYNHSFYSSKSDSLKNEA
SIATPRRPDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGIHLFRTFLKQEECADMLD
FWFACSGFRKQEANDGNEKMLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVTKLHI
DPAMFDQAQTEIQTMMEENTYPLFLKSDIYLEYTRTGGESPKLFSDQSSVSGNGKVLPGY
LPTVIEDVEWRCDQEEEQIAESDPTPSNRLTQKLPLETVPQRVANSKRYQDNREYRHASW
REPVNPYYVNSGYALAPATSANDSEQQSMSSDADTLSLTDSSVDGVPPYRYRKPHRREIH
ESAKVNGRVPLPHIPRTNRIPKDIHVEPEKFAAELISRLEGVLREREAQEKLEERLKRVR
LEEEGDDADISTGPSLANHRVPPAVHVQHYGGRYSEMSYNGLQLRDAHEENPESILDEHV
QRVMKTPGCQSPGTGRHSPKSRSPDGLPAGKIPGLMMPLSGGQGKHQARQGPKGEAAHLH
HHKHIHHTHYAAAGKPKEQAEAEAARMHGGFAWNTEQHHYGPKSRNYADGMSVGPNTMDP
MGYSSKGSTLSKRPVRKGEDGRNFEMREPLPADDMERNQKILQWMMEGEKEAGRYKRGPY
GSISGPKKAQGHEPARPSSVERLGAVHPWVTAQLRNNVQPSHPFIQDPTMPPNPAPNPLT
QLEEARRRLEEERRKSGTLQAKQRHKNMKKQPCENITVAYYFRGEPIPYRTSVKGRIVTL
GQFKELLTKKGSYKYYFKKVSYEFDCGVVFEEVREDDAILPIFEEKIIGKVEKVD
NT seq 2508 nt   +upstreamnt  +downstreamnt
atgagcatgagtgtaaacgagaagggcatctgttatctgccagacctgggcagcagcttc
actgaggatgcccccagacccccggtccctggggaggagggcgatttggtgtccagcgat
ggacggcaatacaaccacagtttttactcgtccaaaagcgacagcctcaagaacgaggcc
tccatagctacgcctagacgacccgacctggacctgggctatgagcccgagggtagcgct
tccccaacgccgccctatttaaaatgggcggaatccttacactcgctgctggacgaccaa
gacggcatccacttgtttaggactttcctcaagcaagaggagtgcgcagatatgctggac
ttctggttcgcttgcagcggattccgcaagcaagaggccaacgatggcaacgagaagatg
ctgaaactcgcgaaggccatttacaaaaagtacatcctggataacaatggaatcgtatcc
cggcagatcaaacccgccaccaagagcttcatcaaagactgcgtgacgaagctgcacatc
gatccggccatgttcgaccaggcgcagacggaaattcagactatgatggaggagaacacc
taccctttgtttttaaagtccgacatttacttggagtacaccaggactggcggagagagt
cccaaactgtttagcgaccagagctcggtgtcaggcaacggcaaagtcttgccgggctac
ttgccgactgtgatcgaagacgtggagtggaggtgcgaccaggaggaggagcagatcgcg
gaaagtgaccccactcccagcaacaggctgacccagaagctgcctctggaaacggtgcct
cagcgggtggccaacagtaaaagatatcaggacaaccgtgagtacagacacgcgtcatgg
agggagcccgtcaatccgtactacgtgaactctggctacgcgctggcgcccgccaccagt
gccaacgacagcgagcagcagagcatgtccagcgatgcagacacgctttccctgaccgac
agcagtgtagacggagtcccaccttacagatatcgtaaaccacatcgacgtgagatacac
gaaagtgccaaagttaatgggcgagtgccactacctcatattcctcgcacaaaccggata
ccaaaggatattcacgttgagccagagaagtttgcggcagagctgatcagcaggctggag
ggggtgttgagggaacgagaggcgcaggagaagctggaggagcgtctcaagagggttcga
ctggaagaggaaggtgatgatgcagacatctccaccggtccctctctggccaatcacagg
gttcctccagcggtccacgttcagcattatggtggtcgctactctgaaatgagctacaac
gggctgcagctaagggatgcacacgaggaaaaccccgaaagcatcctggatgagcatgta
cagcgggtcatgaaaactcctggctgtcaatctccaggtaccggacgccattctccgaag
tcccgctcgccagatgggctgccggcgggtaagattcctgggctgatgatgccgctgtct
ggtggccaaggcaagcaccaggctcggcagggcccaaagggtgaggcggcgcacctgcat
catcacaaacacatccaccacacacactatgctgcggcgggaaagcccaaagagcaggca
gaggcagaggctgcaagaatgcatggaggattcgcctggaacacggagcaacaccactat
ggacccaagtcacgcaactatgcagatggaatgagcgtcggtcccaacaccatggacccc
atgggttacagcagtaaaggcagcacgctatccaagcgaccggtcagaaaaggagaagat
ggtcgaaactttgagatgcgagagcccttacctgctgacgacatggagaggaaccagaag
atactacagtggatgatggagggcgagaaggaagctgggcgttataagaggggcccttac
gggagcatttctgggcccaagaaagctcagggtcatgagccggcccggcccagttcggtg
gagcgtctgggggccgtgcacccatgggtgaccgctcagctccgcaacaacgtgcagccc
tctcatcccttcatccaggacccaaccatgccccccaatccagccccaaaccccctcacc
cagctggaagaggcgcgcaggcggcttgaggaggagagaaggaagtctgggacactgcag
gccaagcagaggcataagaatatgaagaagcagccctgtgagaacatcaccgtggcctat
tatttccgcggtgaacccatcccgtacaggacgtccgtcaaggggaggatcgtcacgctt
ggacagttcaaggagctgctcactaagaaagggagctacaagtattatttcaagaaagta
agctatgagtttgactgcggagtggtgttcgaggaggtacgcgaagatgacgccatcctg
cccatcttcgaggagaagatcatcggaaaagtggagaaggtcgactga

DBGET integrated database retrieval system