KEGG   Danio rerio (zebrafish): 58053Help
Entry
58053             CDS       T01004                                 

Gene name
hoxb6b
Definition
(RefSeq) homeobox protein Hox-B6b
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain
Motif
Other DBs
NCBI-GeneID: 58053
NCBI-ProteinID: NP_571613
ZFIN: ZDB-GENE-000823-7
Ensembl: ENSDARG00000026513
Vega: OTTDARG00000020592
UniProt: B3DHS2
Position
12
AA seq 224 aa AA seqDB search
MSSYFVNSTFPVSLPGGQESFLGQIPLYSSGYTDSLRHYPSATFGATNVQDKVYTSSYYQ
QAGGVFGRSGSTSACDYSTPNIYRSADRSCAIGSLEDSLVLTQDQCKTDCTEQGTERYFS
TEDKPCTPVYPWMQRMNSCNGMPGSTGRRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEI
SHALCLTERQIKIWFQNRRMKWKKENKAVNSAKVSDEEDGGKAG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagttcctatttcgtcaactcaacttttcccgtgtctctacccggaggacaggagtct
ttcttgggtcagataccgctatattcctctggatatacagattctttaagacattatcca
agcgctacgttcggagctaccaatgtccaagacaaggtttacacctcctcgtattatcag
caagctgggggtgtttttgggagaagcggatccaccagtgcttgtgactactcaacaccc
aatatttaccgatccgctgaccgctcgtgcgctattggaagtctggaagactcgctggtc
ctaacccaggaccagtgcaagacggactgcacagaacagggcacagagagatattttagc
actgaagataaaccatgtaccccggtttacccgtggatgcagaggatgaactcatgtaat
ggaatgcctggcagcactggccgcaggggtcgtcaaacctacactcggtttcagactctt
gaactggaaaaggagttccactttaacagatatttgacaagaaggcgaagaattgaaata
tcgcacgctctgtgtttgacggaacgacagatcaagatatggttccaaaaccgcagaatg
aaatggaaaaaggagaataaagcagtgaactcggcaaaggtcagcgatgaggaagatggt
ggaaaggctggataa

DBGET integrated database retrieval system