KEGG   Danio rerio (zebrafish): 58125Help
Entry
58125             CDS       T01004                                 

Gene name
dedd1
Definition
(RefSeq) DNA-binding death effector domain-containing protein 2
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: DED
Motif
Other DBs
NCBI-GeneID: 58125
NCBI-ProteinID: NP_571677
ZFIN: ZDB-GENE-000616-2
Ensembl: ENSDARG00000002758
Vega: OTTDARG00000033178
UniProt: F1QIL7
Position
16
AA seq 369 aa AA seqDB search
MSSVKCSRYSLYWEETECLSYYETLSLHEIFEIVGSQLTETDVEVLSFLLDETYPGKHPL
DPEGWTEDLPPGPDGSPQANTPCPRLLKSWQRMQPQKEGCSIASRHRPKSGVELLLELER
RGYLSDANLRPLLQLLRILTRHDVLPFVSQKKRRTVSPERQKIDYPEVDFRQDREVGSNT
NIPSFENTQDHHWRAGSGSSMTSASSNRRKRGRGHHWSRKSRGPPEIQPQSTPNKVTCDI
RLRVRAEYSEHESALRGGVSSDKPQPLERQFELFSRASLLLRTRDLGSIVCDIKFSELTN
LDAFWADYLSGALLEALKGVFITDSLKRAAGQEGVRLLVSVDQDDYEEGRKLLINSQTQN
WTNWEAQRP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagtgaaatgctcaagatattccctgtactgggaggagactgagtgcctgagc
tactacgagacgctttcactccatgagatctttgaaatcgtgggttctcaactcacagag
actgatgtggaagttctgtcctttctcctcgacgaaacttatcctggtaaacatcctctt
gatccagaggggtggactgaagatctgcctccaggacctgatggatctccacaggctaat
actccgtgtcctcggcttctgaagtcatggcaaagaatgcagccgcagaaggagggatgt
tctatcgccagtcgccaccgacccaagagtggcgtcgaactgctgttagagctggaaaga
cgagggtacttgagcgatgcaaatctaagacctctacttcagttgctgcggattctgacc
cgacatgatgtcctgccttttgtctcacaaaagaaaagaagaaccgtttctccagaacga
cagaagatagactatccagaggtggattttagacaagacagagaagtgggctcaaacaca
aatataccatcttttgaaaacacacaagatcatcattggagagctggttctggctcttca
atgacatcagcctccagcaatcgaagaaagcgaggaagaggtcaccactggagcaggaaa
tcaagagggccgcctgaaatccagcctcagtcaacacccaacaaagtgacgtgcgatatc
cgactgcgggtgcgagcggagtattcggagcatgagtcggctcttcgtggaggggtttcc
tcagacaagccgcagccgctggagaggcagtttgagctgttcagccgggccagtttgctg
ctccgcactcgcgatctgggctctattgtgtgtgacatcaagttctctgagctcaccaac
ctggacgccttctgggcggattacctgagcggggcgctactcgaggcgctgaagggggtc
ttcattacggactccttgaaaagggcagcagggcaggagggtgttcggctgctggttagt
gtggatcaggatgactatgaggagggcaggaaactgctgatcaacagccagacacaaaac
tggacaaactgggaagcacagaggccctga

DBGET integrated database retrieval system