KEGG   Danio rerio (zebrafish): 58131
Entry
58131             CDS       T01004                                 

Gene name
apaf1
Definition
(RefSeq) apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04115  p53 signaling pathway
dre04210  Apoptosis
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    58131 (apaf1)
   04115 p53 signaling pathway
    58131 (apaf1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    58131 (apaf1)
SSDB
Motif
Pfam: WD40 APAF1_C NB-ARC ANAPC4_WD40 CARD Ge1_WD40 WD40_like CARD_2 PQQ_2 NACHT AAA_16
Other DBs
NCBI-GeneID: 58131
NCBI-ProteinID: NP_571683
ZFIN: ZDB-GENE-000616-4
Ensembl: ENSDARG00000021239
Vega: OTTDARG00000024044
UniProt: Q9I9H8
Position
4
AA seq 1261 aa
MEERARSRLLRSKATLEQDIKASYLMDHMISDGVLTNDEEAKVLSKATRKEQAVALLETL
LRKDNRAYISFYNALIRESYGDLASLLHSDLPLLSPEGEKSFADGVSPSVQAILSVGGVP
QRPVVFVSRPPLLNLIREMLYQLRDTPGWVTVFGMAGSGKSVMAAEVVRDRSLIKECFPD
GVHWLSVGQCERADLLVRMQSLCFRLEQCQSSDTSQRPPSTVEEAKERLRFLMLRRFPRS
LLILDDVWDSSSLRSFDIQCRVLLTTRNRALTDSVSGVRYEVPVENGLDEEKALEILALY
VNGKMHKLPEQARSIVSECKGSPLVVSLIGALLREFPDRWSYYLRQLQQKQFKRIRKSSS
YDYEALDQAMDASLQVLEAEHQELYRDLSVMQKDIKVPAKVLSVLWGLELEEVEDVLQEF
VNKSLLFRDCNQRPYRYYLHDLQLDFLAEQNRDQIAELHKKMVRQYQRFYSKRPPDSADK
DSLYWYQFIPYHMAKAGLSKELYSLMFSLDWVKEKARIMGSAHLINDYVEYGEILDKENS
EVRVQFQEFLSLNGHHLEQRPFPDVVQLALSQPDRSEVYRQALMQAQKRASRGQIYLNWV
NKNIEEGLSRLVMHPHQGAVYYACFSKDGSKIASCGASKALRVFKSTSGEKLLELQAHEE
DVLCCAFSPDDRHIATCASDRKVKLWNVERGVLIREFEVEHEEQINHCQFTNTGRRVLLA
TCSNDKFTNTRLWNPNKKTSQNTMFGHMEPVNHCCFSPNDLYLATSSSDGSLKLFEVSSA
NEWKSIDVDSFFPESDEEIKAMVKCSTWSADGSQIICAARNTVFVFDVETSDLLLKLKTS
RLSTIQFCHACPNSSLLAVALSHYTVELWNFESSKKKAECSGHLSWVHCVQFSPDGSLLL
SSSDDQTIRLWETDRVHTSSAVALKRDTDVLSSHSDATIIAPDSSNRLQVLSGSTGAVVL
ESEELSSRIRCSCISRNAAFVALGSEDGTVQVIEVPSSKASVKLSGHTKTVHHCQFTDDC
EILITSSEDSTIRVWKWRTGECMVLQGHMEPVRKFHLLSSSSSPHLFSWSFDGTVKVWDL
TRGQMLQDLVCHEGAVLSCDVSSDGRLFATTSANRTAKVWSSASWKMLFLLEGHKDCVRS
CRFSWDNKRLATGDDNGEIRLWSMLDGALLKICPRDTKDSMNSYHAGWVTDLHFSPDNRV
LVSTAGYIKWWSVESGEALQTFYTMGGNLKKIHVSPDFSTFITVDSIGILYILKRLEGEG
T
NT seq 3786 nt   +upstreamnt  +downstreamnt
atggaggaacgtgcccgcagccgcctgctgcgctccaaagccactctggagcaggacatc
aaagcctcctacctgatggaccacatgatcagcgatggcgttctaaccaatgatgaggaa
gcaaaagtgctcagcaaggccactagaaaagagcaggccgtggctctgcttgagaccctg
ttgaggaaagacaatcgtgcctacatttccttctacaacgccctgatcagggagagttat
ggagatctggccagtctccttcacagtgatctgcctctgctcagccctgagggagagaag
agcttcgctgatggagtctctccctctgtccaggcgattctgagtgtaggaggtgttcct
cagagacctgtggtgttcgtgagtcgacctccactgctcaatctgatccgggagatgctg
taccagctgcgggacacaccgggctgggtgactgtatttggcatggctggctcagggaag
tctgtgatggctgccgaggttgttcgagatcgttcactcattaaggagtgttttcctgat
ggtgttcactggctgtctgtgggtcagtgtgagcgggcagacctgttggttaggatgcag
tctctgtgctttcgtttggagcagtgtcaaagttcagacaccagtcagcggccacccagc
actgtggaggaggccaaagagcgcctgcgcttcctaatgctccgcagattccccaggtct
ctgctgatcctggatgatgtctgggacagttcttccctcaggtcttttgatatccaatgc
agagttcttctgaccacacgcaatcgagctctgactgattccgtcagcggtgtaaggtat
gaagtgcctgtagagaacggtctggatgaggaaaaagccttggaaattcttgctttgtac
gttaatgggaagatgcacaaactcccagaacaggcccgcagcattgtaagcgaatgtaaa
ggttctcctctggtggtttctctgattggagctctgctgagggagttccctgaccgctgg
agctattacctgcgacagttgcagcagaagcagttcaagcgcattcgcaagtcttcatcc
tatgactatgaagcactggaccaggccatggacgctagcctgcaggttctggaggccgaa
caccaagagctgtacagagacctgagcgtcatgcagaaagacatcaaagtgcctgctaag
gttctgtctgttctgtggggtcttgagctggaggaggtagaggacgtcctgcaggagttt
gtcaataaatctctgctttttcgggactgtaatcagcgaccatatcgatattaccttcat
gatctgcagctggatttcctcgctgaacaaaaccgtgatcagattgctgaactacataaa
aagatggttcgtcagtatcagaggttctacagtaaacgcccacctgactctgcagataaa
gactcgttgtactggtaccagttcatcccgtatcacatggctaaagcaggactgtcgaag
gagctttattcactgatgttttccttggactgggtcaaagagaaggctcggattatggga
tctgcccatctcatcaatgactatgtggaatatggggaaatactagataaagagaatagt
gaagtgcgagtgcagtttcaggagttcctttctctgaatggtcatcatctggagcagagg
ccgttccctgatgtggtccagttggctctgtctcagcccgatcgctctgaggtttacaga
caggcactgatgcaggcgcagaaacgggccagcagagggcagatctacctcaactgggtg
aataaaaatattgaggagggtttgtctcggctagtcatgcaccctcaccagggggctgtc
tactatgcctgcttctcaaaagacgggagtaaaattgcctcttgtggagccagcaaggca
cttcgggtgtttaaatcgacctctggagagaagcttttggagcttcaggctcacgaggaa
gatgttttatgctgtgccttttcccctgatgaccggcatatagcaacatgtgccagtgac
aggaaggtgaagttgtggaatgttgagcgaggtgttcttatcagagagtttgaagttgaa
cacgaggagcagatcaaccactgccagttcaccaacacaggccgaagagtcctgctggcc
acctgctcaaatgacaaattcactaacaccaggttgtggaaccctaacaaaaagacgtct
cagaacactatgtttggacacatggagccggtcaatcactgctgtttttctcctaatgac
ctttacctcgccacttcatccagtgatggcagcttgaagctgtttgaagtgtcatctgcg
aacgagtggaaatcaattgatgtcgatagtttttttcctgagagtgacgaagaaataaag
gccatggtgaaatgcagcacttggtcggctgacggctcacaaatcatctgtgctgccaga
aacacagtgtttgtgtttgatgtggagacgtcagacctgctgctgaagctgaagacgagt
cgtttgagcactattcagttctgtcatgcgtgtcctaacagcagcctgctggccgtcgct
ctctcgcattacaccgtagagctgtggaacttcgaaagcagtaagaagaaagccgaatgc
agtggtcatctgagctgggttcactgtgtgcagttttcacccgacggctcactcctgctg
tcctcctctgatgatcagactatcaggttgtgggagacggaccgggttcacacttcttct
gctgtggctctgaagagggacactgatgtgctgtcctctcacagtgatgctacgatcatc
gcacccgatagcagtaacagattacaggtgctgagtggatctacaggtgctgttgtgctt
gagagcgaggagctgtcatccaggatccgctgttcgtgcatcagcagaaacgctgcattt
gtggctctgggatctgaggacggaacagtacaggtgattgaggttccttcttcaaaggca
tcagtgaagctttcaggccacactaagactgttcaccactgccagttcactgacgactgt
gaaatccttataacatcctcagaagattccactatccgggtgtggaagtggaggaccggc
gagtgtatggtgctgcagggtcatatggagccggtcaggaagtttcacctcttgagctct
tcatcttctcctcatctgttctcatggtcgtttgatggcacagttaaggtctgggatttg
accagagggcagatgctgcaagaccttgtgtgtcatgagggtgccgtcctgtcatgtgat
gtgtcctctgatggacgcctctttgccaccacctcagctaataggactgctaaggtgtgg
agcagtgcctcatggaaaatgttatttttgttggagggacacaaggattgcgttcgtagc
tgccgtttttcttgggacaacaagagacttgcaactggcgatgacaatggagaaatccgg
ctgtggagcatgctggatggagctctcctgaagatctgtcctcgggacactaaagactcg
atgaactcataccatgcgggatgggtgactgatctgcacttctctcctgataacagggtg
ctcgtctctactgcgggatacatcaagtggtggagcgtggagagcggagaggcgctgcag
accttctacacgatgggaggcaatctgaagaagatccacgtgtctcctgacttcagcacc
ttcatcactgtggacagcatcggcatcctttacattttaaagagacttgagggagaggga
acatga

DBGET integrated database retrieval system