KEGG   Danio rerio (zebrafish): 619260
Entry
619260            CDS       T01004                                 

Gene name
srp14
Definition
(RefSeq) signal recognition particle 14 kDa protein
  KO
K03104  signal recognition particle subunit SRP14
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03060  Protein export
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    619260 (srp14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dre02044]
    619260 (srp14)
Secretion system [BR:dre02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   619260 (srp14)
SSDB
Motif
Pfam: SRP14 DUF3509
Other DBs
NCBI-GeneID: 619260
NCBI-ProteinID: NP_001028913
ZFIN: ZDB-GENE-050913-131
Ensembl: ENSDARG00000115987
UniProt: Q4V9I5
Position
17
AA seq 110 aa
MVLLENDAFLTELTRLFQKCRSSGSVLITLKKYDGRTKPVPRKGHPETFEPADNKCLLRA
SDGKRKISTVVSTKEVIKFQMAYSNLLRAHMDGLKKKDKKSKSKKTKATQ
NT seq 333 nt   +upstreamnt  +downstreamnt
atggtgttattggaaaacgacgcgtttctgacagaactgactcggctcttccagaagtgc
aggagcagcggcagcgtcctcatcaccctcaagaagtatgacggcagaacgaagccagtg
ccgaggaaaggccatccagagacatttgagccggcggataataaatgtctcctcagagct
tcagacggcaagaggaaaatcagcacagtggtcagcactaaagaagtaataaaatttcaa
atggcgtattcgaacttgttgcgagcgcacatggacggcttgaaaaagaaggacaaaaag
agtaaaagcaagaaaactaaagccacacagtga

DBGET integrated database retrieval system