KEGG   Danio rerio (zebrafish): 641289Help
Entry
641289            CDS       T01004                                 

Gene name
uba52
Definition
(RefSeq) ubiquitin-60S ribosomal protein L40
  KO
K02927  large subunit ribosomal protein L40e
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    641289 (uba52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dre03011]
    641289 (uba52)
Ribosome [BR:dre03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    641289 (uba52)
  Archaea
    641289 (uba52)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 641289
NCBI-ProteinID: NP_001032190
ZFIN: ZDB-GENE-051023-7
Ensembl: ENSDARG00000041435
Vega: OTTDARG00000034723
UniProt: Q3B7P7
Position
2
AA seq 128 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCEKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKLK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcttcgtgaaaacgttgaccggtaaaaccatcaccctcgaggtggagcccagc
gacaccatcgagaatgtcaaggctaagatccaggacaaagaaggaatcccgcccgatcag
cagcgtctgatcttcgctggtaaacagttggaggatggacgcacactgtcagactacaac
atccagaaagagtccactcttcacctggtgctgcgtctgagaggaggaatcatcgagcct
tctctccgtcagttagctcagaaatacaactgtgagaagatgatctgccgcaagtgttat
gctcgtctgcatcctcgtgccgtcaactgccgcaagaagaagtgcggacacaccaacaac
ctgcggcccaagaagaagctgaagtag

DBGET integrated database retrieval system