KEGG   Danio rerio (zebrafish): 641291
Entry
641291            CDS       T01004                                 

Gene name
ahrra
Definition
(RefSeq) aryl-hydrocarbon receptor repressor a
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    641291 (ahrra)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    641291 (ahrra)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 641291
NCBI-ProteinID: NP_001030342
ZFIN: ZDB-GENE-051018-1
UniProt: Q3T2L3
Position
24
AA seq 550 aa
MIPPGDCLYAGRKRRKPIQKQKPAALMSEKSNPSKRHRERLNAELERLAELLPFGPDTVC
KLDKLSVLRLSVSYLRIKSFCSVLAQENPCETQTSKNQQDTPAACVPESQLLLESLAGFA
LVVSGDGMVFYASSTIADYLGFHQTDVMHQNVFDYIHVDDRQEFRRQLHWAMNPPNPEAQ
SSGTAEEFAVSSLFQSDQPAGVPPELSCFLSRCFILRVRCLLDSTSGFLTMQFQGQLKFL
HGQRRRAVSGAALPPALALFCVAVPLLPSGPDLKMRSRQRGPGALPVPQHTDREDPLRRA
GTHTLFSRDAVKRRTEGLYAADQPQSVWPRTAPAVDMTARRHTHYGKPSRSAGYSRAECV
EFSFQPHGDDYNTHTHLLEPQVKLEPDSDCENGSGACGRYNTHGGACERYNTHGAACERY
NTHGAACERYNSAGGHTHMGAQVKLEDGFGQQFSCQRMKPPYAGHYYTPPRPLKCVLNRE
AASGTLNTHCTDAYTADYRGYMQQDYKAGYEFKGHGLVHSIKQEPLDPQHWDTLMMSCGS
GRADTHTCTH
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgattccgcctggagactgtctttacgccgggaggaagaggaggaagcccatacagaag
cagaagccggcggcgctgatgtcggagaagtcaaacccgtcgaagcgtcaccgcgagcgt
ctgaacgcagagctggagcgtctggcagagctgctgcccttcggccccgacaccgtctgc
aaactggacaaactctccgtcctcagactcagcgtcagctacctgcgcatcaagagcttc
tgcagcgtgttggctcaggaaaacccctgcgagacccagacgagcaagaaccagcaggac
acaccagcggcctgcgtcccggagagccaactgctgctagagtctttggcagggtttgcg
ctggtcgtcagtggagatgggatggtcttctatgcctcctccaccatagctgattacctg
ggcttccaccagacagacgtgatgcaccagaacgtgttcgactacatccatgtggacgac
cggcaggagttcagacggcagctgcactgggccatgaaccccccgaaccctgaggcgcag
tccagcggcacagcggaggagttcgcagtcagcagcctgttccagtctgatcagccggcc
ggtgttccaccagagctctcctgcttcctgagccgctgcttcatcctgcgggtgcgctgt
ttactggacagcacctctgggttcctgactatgcagttccagggtcagctgaagttcctg
cacgggcagaggaggagggcggtgtctggggcggcactgcctccagcactagccctgttc
tgtgtggccgttcccctgctgccgtccggccctgatctgaagatgaggagccgccagcgg
ggccctggggccctccccgtaccgcagcacactgacagagaggatcctctcagacgtgca
ggaacacacaccctgttctccagagatgcagtgaagcgcaggactgaaggcctgtacgcc
gcagaccagccccagagtgtgtggccccggacggcccccgcggtggacatgacggcacgc
agacacacacactacgggaaaccctcccgttcagccggatacagcagagcggagtgtgtg
gagttcagcttccagccgcacggagatgactacaacacacacacacacctgctggagccg
caggtgaagctggagccggactcggactgtgagaacggcagcggtgcgtgcggacgctac
aacacacacggcggcgcatgcgaacgctacaacacacacggcgccgcatgcgaacgctac
aacacacacggcgccgcatgcgaacgctacaacagcgcaggcggacacacacacatgggt
gcgcaggtgaagctggaggacgggttcgggcagcagttctcctgccagcggatgaagccg
ccgtacgccggacactactacacccccccacggcccctgaagtgtgtgttgaacagagaa
gcggcctccggcacactcaacacacactgcactgacgcctacactgctgactacagaggg
tacatgcagcaggactacaaagcaggctacgagttcaaaggtcacggcctcgtccactcc
atcaaacaggagccgctggaccctcaacactgggacacactgatgatgagctgcgggagc
ggcagggccgacacacacacctgcacacactaa

DBGET integrated database retrieval system