KEGG   Danio rerio (zebrafish): 641488Help
Entry
641488            CDS       T01004                                 

Gene name
ugt1a1
Definition
(RefSeq) UDP glycosyltransferase 1 family, polypeptide A1 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00040  Pentose and glucuronate interconversions
dre00053  Ascorbate and aldarate metabolism
dre00140  Steroid hormone biosynthesis
dre00830  Retinol metabolism
dre00860  Porphyrin and chlorophyll metabolism
dre00980  Metabolism of xenobiotics by cytochrome P450
dre00982  Drug metabolism - cytochrome P450
dre00983  Drug metabolism - other enzymes
dre01100  Metabolic pathways
Module
dre_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    641488 (ugt1a1)
   00053 Ascorbate and aldarate metabolism
    641488 (ugt1a1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    641488 (ugt1a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    641488 (ugt1a1)
   00860 Porphyrin and chlorophyll metabolism
    641488 (ugt1a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    641488 (ugt1a1)
   00982 Drug metabolism - cytochrome P450
    641488 (ugt1a1)
   00983 Drug metabolism - other enzymes
    641488 (ugt1a1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     641488 (ugt1a1)
Glycosyltransferases [BR:dre01003]
 Others
  Hydrophobic molecule
   641488 (ugt1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 641488
NCBI-ProteinID: NP_001032505
Ensembl: ENSDARG00000006220
Vega: OTTDARG00000010754
UniProt: F1QAF6
Position
9
AA seq 525 aa AA seqDB search
MRTLPVPAQGLLALLCLFSFESVQAGKVLVLPVDGSHWLSMKILVEELSNRGHEMVVLVP
ETSILIKKSGKYSTKTYPVSFTHDDLAENLKEIQNSALEKAPKLTDIVVNFRNLLQFLTM
QSKTCEGLLYNEPLMKSLREMGFDAMLTDPFLPCGTIIADSFSIPAVYFLRLIPCRLDEA
AAQCPSPPSFMPRYSSGFTDKMTFPQRLVNTLLTVVEGFLCRSMYESADELASKYLQKET
TYAELLGHGAVWLLRYDFAFEFPRPQMPNMVQIGGINCVKRAPLTKELEEFVNGSGEHGF
VVFTLGSMVSQLPEAKAREFFEAFRQIPQRVLWRYTGPVPENAPKNVKLMKWLPQNDLLG
HPKVRAFVTHGGSHGIYEGICNGVPMVMLPLFGDQGDNAQRLVSRGVAESLTIYDVTSEK
LLVALKKVINDKSYKEKMMKLSAIHRDRPIEPLDLAVFWTEFVMRHKGAEHLRPAAHDLN
WIQYHSLDVIGFLLLILLTVIFVTVKSCMFCFRKCFKKSQKKKKA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagaacactgcctgttcctgctcaggggcttctcgccttgctgtgcttgttctctttt
gagtctgtgcaagctggaaaggtgcttgtcttaccagtggatggcagccattggttgagc
atgaagatcctagtggaagagctgtctaataggggacatgagatggtcgttctggtccct
gaaactagtattctgataaaaaaatctgggaaatacagcaccaagacttatcctgtctcc
ttcacccatgatgatctggctgaaaatttgaaagagatacagaacagtgcattggagaag
gctcccaagttaactgatattgttgtcaatttcaggaatctattgcaattcctaactatg
cagtcgaaaacatgtgaaggactgctgtacaacgagcctctgatgaagagtctaagagaa
atgggatttgatgctatgctcacggatcctttcctgccctgtggcactatcattgctgac
tccttctcgattcctgctgtttacttcttgcgtttgattccttgtcgtcttgatgaagca
gctgctcagtgtccttcacctccttcttttatgcctcgctactccagtggttttacagat
aagatgactttccctcagagactagtaaacacacttttgacagttgttgaaggtttcctt
tgccgcagcatgtatgaatctgcagatgaactggcctctaaatatttgcagaaggaaact
acctacgcagagctgttaggtcatggtgcagtttggcttttaaggtatgactttgccttt
gagttccctagaccgcaaatgcccaatatggtccagataggtggaatcaactgtgtaaag
agggctccactgaccaaggaactggaggagtttgtgaacggctctggagagcacgggttt
gttgtcttcactctgggctccatggtgtcacagctacccgaagccaaagccagagagttc
tttgaggcatttagacagatacctcagagagtgttgtggagatacactggaccagtccca
gaaaatgcaccaaagaatgtcaaattaatgaaatggctgccacagaatgacctcttgggc
catcctaaggttagggcttttgttacacatggtggatcacatggaatctatgaaggaatc
tgtaatggagtgcctatggtgatgcttcctctgtttggagaccaaggggataatgctcag
cgtttggtgtctcgaggagtcgcagaaagcctgactatctatgatgtgacctccgaaaaa
ctgctggttgcattgaagaaagtcatcaatgataaaagctacaaggagaagatgatgaag
ctctctgccattcatagagaccgtccaattgaaccactggacctggctgtgttctggact
gagtttgtcatgagacacaaaggagcagagcatctcagacctgcagcccatgacctgaac
tggattcagtatcactctctggacgtcatcggcttccttcttcttattctattgactgtt
atttttgtgactgtcaaaagctgcatgttctgtttcagaaagtgcttcaagaaatctcag
aagaagaagaaggcataa

DBGET integrated database retrieval system