KEGG   Danio rerio (zebrafish): 641570
Entry
641570            CDS       T01004                                 

Gene name
bpnt2
Definition
(RefSeq) inositol monophosphatase 3
  KO
K15759  Golgi-resident PAP phosphatase [EC:3.1.3.7]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00920  Sulfur metabolism
dre01100  Metabolic pathways
dre04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    641570 (bpnt2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    641570 (bpnt2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     641570 (bpnt2)
SSDB
Motif
Pfam: Inositol_P Rho_RNA_bind
Other DBs
NCBI-GeneID: 641570
NCBI-ProteinID: NP_001032657
ZFIN: ZDB-GENE-051127-23
Ensembl: ENSDARG00000058114
Vega: OTTDARG00000021461
UniProt: Q2YDR3
Position
2
AA seq 341 aa
MAPMGIRLSPLGIAVFCLLGVGVIYHLYAGVLSSRLAFFRQKRTVDLRELLALSIDAAVQ
GGREVKRIREDNTLEEKSKGKTKEGASEKYTLGDLNSHRKMYYLIKNTFPNIQVNSEEHA
NAEGEATVWTRMIPEDILAKVSGGKEIPAEKITVWIDPLDATQEYTENLLKYVTTMVCVA
VDGEPVIGVIHKPFTGYTVWGFVGEGSNVAPRDSYNTNSPKVIVSRSHAGKVKSFVQTAF
GNNTEIIPAGGAGYKALALLNPTDDKQETADIYIHVTYIKKWDICAGDAILKSLGGQMTT
LKGEQIDYSGLEGNKGGLLASMKVDHKALVKRLPLWEDNKQ
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggctcctatgggcatccggctgtcgccgctcggcatagccgtgttctgtttactcggg
gtcggtgtgatttatcacctgtacgcgggggttttgtccagcagactcgcctttttccgc
cagaagaggaccgtggatctgagagagctgctggcgctgtccatagacgctgcggtgcag
ggcggacgggaggtgaagaggatccgggaggacaacacactggaggagaagtcaaagggc
aaaacgaaagaaggggctagcgagaagtacacgctgggggatctcaactcccaccgcaag
atgtactacctgatcaagaacacattccctaatatacaggtaaactcagaagagcacgcg
aacgctgaaggtgaggccacagtgtggacacgaatgatccctgaagatattcttgctaaa
gtctcaggcgggaaggagattcctgcagaaaagatcacagtctggattgatccactggac
gccactcaggaatacacagaaaatctcctgaagtatgtcacaaccatggtgtgtgtggct
gtggacggggaacctgttataggtgtgatccataaacccttcactgggtacacagtttgg
ggttttgttggagagggatccaatgtggctccacgtgattcctacaacacaaactctccg
aaggtgatcgtctctcgctctcacgctggcaaagtgaagagcttcgttcaaacggcgttc
ggcaacaatacagaaatcataccagcagggggcgcaggatataaggcactggctctccta
aaccccactgatgacaaacaagagacggctgatatctacatccacgtcacatacatcaaa
aagtgggatatctgtgcgggcgacgccatcctgaagtctctcggtggtcagatgacgact
ctgaaaggagagcagattgattactctgggttagaaggaaacaagggcggtctgttagcc
agcatgaaagtcgatcacaaagcattggtgaaaagacttccactctgggaagacaacaaa
caataa

DBGET integrated database retrieval system