KEGG   Danio rerio (zebrafish): 64604
Entry
64604             CDS       T01004                                 

Gene name
nrf1
Definition
(RefSeq) nuclear respiratory factor 1 isoform 1
  KO
K11831  nuclear respiratory factor 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    64604 (nrf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dre03029]
    64604 (nrf1)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    64604 (nrf1)
SSDB
Motif
Pfam: Nrf1_DNA-bind Nrf1_activ_bdg Gram_pos_anchor
Other DBs
NCBI-GeneID: 64604
NCBI-ProteinID: NP_001315469
ZFIN: ZDB-GENE-001221-1
Ensembl: ENSDARG00000000018
Vega: OTTDARG00000002253
UniProt: Q90X44
Position
4
AA seq 514 aa
MEDHTVHQTEHMTTIEAHAVSQQVGQVHVATYTEHGMLSADEDSPSSPDDDAYDDSDILN
STGTDEVTAHLAAAGPVGMAAAAAVATGKKRKRPHIFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFRVFGAAPLENVVRKYKSMILEDLENALAEHAPPGGG
ELSSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIP
WANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQVTTQVATTATHSIA
HLVPSQTVVQTISNPDGTVSLIQVGTGATVATLADASELPGTVTVAQVNYSTVTDGEVEQ
NWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQTGATVTMALNRYSLEGALKFG
EAAAHAVATLAEATLQGGGQIVLAGETAAAVGALTGVPDGSGLVQIPVSMYQTVVTSLAQ
GNRPVQVAMAPVTTRIDNTMTLDGQAVEVVTLEQ
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggaagaccatacggtgcatcagacggagcatatgaccactatcgaggcccacgccgtc
tctcagcaggtcgggcaggtgcacgtcgccacatacacagagcatggcatgctgagcgcc
gacgaggattcgccctcctcgcctgacgatgatgcttatgatgactccgacatcctcaat
tcaactggaacagatgaagtcaccgcacatctggctgctgctgggcctgttggcatggca
gcagctgccgctgtggcaacaggaaagaagcgtaaaaggcctcacatctttgaatcaaat
ccttcaatccgtaaaagacaacagacgcgcctgcttaggaagctgagagcaactctagac
gaatacacaacacgggtaggccagcaggctattgttttatgcatatctccctctaaacca
aatcctgtgtttagagtatttggagcggcaccactggagaatgtggtgaggaaatacaag
agcatgattctggaggatctggaaaacgctctggctgaacacgcaccccctggtggagga
gaactcagctctgaacttcctccgctgactattgatgggataccagtgtctgtggacaag
atgacacaggcccagctccgagcgttcattccagaaatgctgaagtattccacaggccga
gggaagcccggctgggggaaagagagttgcaagcccatctggtggccagaggacattccc
tgggccaacgtgcgcagtgacgtccgaacagaggagcagaaacagagggtgtcatggacg
caggccctgaggactatcgttaaaaactgctataagcagcatgggagagaagacctgctc
tatgcctttgaggaccaggtcaccacacaagttgccacaacagccacacacagcattgcg
cacctggtgccgtcacagacggtagtgcagacgatcagtaatcctgatggaacagtctca
cttatacaggttggcactggagctacagtagcgacactggcagatgcgtcagaattgcct
ggcacagtgacagtagcccaggtgaactactccacagtgacggatggagaggtggagcag
aattgggccacacttcagggaggcgagatgaccatccaaaccacacaagcgtcagaggcc
acgcaggctgtggcctctttagccgaagctgcagttgcagcttcgcaagagatgcaaacc
ggggcaactgtaaccatggccctcaacaggtactccttggagggagcactgaagtttggt
gaagcagcagctcacgcagtagcgacattagcagaagcgactcttcaaggcggaggacag
atcgtgttagcaggagaaacggctgctgcagtcggagcgttaactggagttccggatggc
agtggtctcgtccaaattccagtcagcatgtatcagactgtggtcaccagtttggcccag
ggcaatcggcccgttcaggtggcaatggctcccgtaacgactcgaatcgacaacacgatg
actcttgacgggcaggcggtggaagtggtgaccctggaacagtga

DBGET integrated database retrieval system