KEGG   Danio rerio (zebrafish): 65228
Entry
65228             CDS       T01004                                 

Gene name
aspn
Definition
(RefSeq) asporin precursor
  KO
K08120  asporin
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:dre00535]
    65228 (aspn)
Proteoglycans [BR:dre00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    65228 (aspn)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRRNT LRR_9 DUF3557 DUF5102
Other DBs
NCBI-GeneID: 65228
NCBI-ProteinID: NP_571788
ZFIN: ZDB-GENE-041105-7
Ensembl: ENSDARG00000002192
Vega: OTTDARG00000009239
UniProt: Q1LXA7 Q6DBT8
Position
22
AA seq 370 aa
MKVLLLLALLTLCNAKPYKHINVMEFMKHHDIMQQDAGDFDDDDDDDDDDDKDYDDYDDN
FVTDCPEGCRCSKKVLQCSDQGLTKVPKDIPANTLLLDLQNNDITEIKEDDFKGLDNLYA
LFLLNNQISKIHPKAFRNMNKLKILHLSYNLLTQMPENLPISVQSLRLHDNKISRLPKGA
FKGMHDLNVLELSANPITNSGIDVGAFDDMATLYLRIAEAKLTAIPKDLPSSLNELHLDY
NKIAKVESEDFLRLKGLQRLWLDFNQIKYVENGTFAATPKVREIHLDNNKLKKIPPGLNT
LKYLQVMYLHANSIGYVGVNDFCPSRTRAKKALYTRISLYANPVKYWEIQPPTFRCVSSH
NSVQLGNHRK
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaaggtacttttactactcgccctactaacgttatgtaatgcaaagccatacaaacat
atcaacgtcatggagttcatgaagcatcatgacatcatgcaacaagacgcgggtgatttt
gatgatgatgatgacgacgacgatgacgacgataaagattatgatgattacgatgataat
tttgttacggactgtcctgaaggatgtcggtgctcaaagaaggttctccagtgctcagat
cagggtctgaccaaagtgccaaaggacattcctgcaaacacgttgctcctcgaccttcaa
aataatgacatcacggaaattaaggaagatgatttcaaaggcctggataatctctatgcc
ttgtttctgctcaataaccagatatccaaaattcatccaaaggccttccgcaacatgaac
aagctcaagattctccacctgtcatacaacttgctgacgcaaatgccagagaatcttcct
ataagtgttcaatcattgcgactgcacgacaacaagatcagcagacttccaaaaggagcg
tttaagggaatgcatgacttgaatgttttagaactgagtgcaaatccaattacaaacagt
gggattgatgttggagcttttgatgacatggcaaccctttacttaagaatagctgaagca
aagctcacagccatccctaaagatcttccatcttccctcaacgaacttcacttggactat
aacaagattgccaaagtggagtcagaggacttcttgagattaaaaggtctacaaaggctt
tggcttgacttcaatcaaatcaagtacgtagagaatggaactttcgctgccactcccaaa
gtcagagagattcatttagacaataataaactgaagaaaattcctccaggcctgaacacc
ctgaaatatttacaggtgatgtacttacacgccaacagcattggctacgttggagtaaat
gacttttgcccctcgagaacccgggctaagaaagccctctacactagaatcagtttatac
gcaaacccagtgaaatactgggagattcagccacccaccttccgctgcgtttccagccac
aattcggtgcaactgggaaaccatagaaagtga

DBGET integrated database retrieval system