KEGG   Danio rerio (zebrafish): 65237Help
Entry
65237             CDS       T01004                                 

Gene name
mapk14a
Definition
(RefSeq) mitogen-activated protein kinase 14A
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04068  FoxO signaling pathway
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04370  VEGF signaling pathway
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04933  AGE-RAGE signaling pathway in diabetic complications
dre05132  Salmonella infection
Module
dre_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    65237 (mapk14a)
   04370 VEGF signaling pathway
    65237 (mapk14a)
   04068 FoxO signaling pathway
    65237 (mapk14a)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    65237 (mapk14a)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    65237 (mapk14a)
   04621 NOD-like receptor signaling pathway
    65237 (mapk14a)
   04622 RIG-I-like receptor signaling pathway
    65237 (mapk14a)
   04625 C-type lectin receptor signaling pathway
    65237 (mapk14a)
  Endocrine system
   04912 GnRH signaling pathway
    65237 (mapk14a)
   04914 Progesterone-mediated oocyte maturation
    65237 (mapk14a)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    65237 (mapk14a)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    65237 (mapk14a)
  Infectious diseases
   05132 Salmonella infection
    65237 (mapk14a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     65237 (mapk14a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   65237 (mapk14a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Aft1_OSA Kinase-like
Motif
Other DBs
NCBI-GeneID: 65237
NCBI-ProteinID: NP_571797
ZFIN: ZDB-GENE-010202-2
Ensembl: ENSDARG00000000857
Vega: OTTDARG00000020254
UniProt: Q9DGE2 B2GPM7
Position
8
AA seq 361 aa AA seqDB search
MSQKERPTFYRQEVNKTIWEVPVQYQNLSPVGSGAYGSVCSAFDAKTGFKVAVKKLSRPF
QSIIHAKRTYRELRLLKHMRHENVIGLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNVTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPSSLISRMPSHEARTYISSLPQMPKRNFADVFIGANPQAVDLLEKMLVLDTDKRITA
AEALAHPYFAQYHDPDDEPEAEPFDQSFESRELDIEEWKRQTYEEMISFEPPVFDVDEME
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaaagaaagacccactttctatcgacaggaggtcaacaagacgatttgggag
gtccccgtgcagtatcagaacttgtctcccgtgggctccggtgcatacggatctgtttgc
tctgcgtttgatgcaaagacaggatttaaagttgctgtgaagaagctctcgaggccattt
cagtccatcatccatgccaagcggacctacagggagctgaggctactcaagcacatgaga
catgagaatgtgatcggcttgctggatgtttttacacctgccacaagtctgaaggagttt
aatgatgtgtacctggtgactcaccttatgggcgctgacctgaataacatcgtaaagtgt
cagaaactgaccgacgatcacgtccagttcctcatttaccagatactgagaggactaaag
tacatccattcagctgacataattcacagggatttgaaacccagtaatctggcagtaaat
gaagactgtgaactcaagattcttgactttggcttggctcgacacacagatgatgagatg
actgggtatgtggccacaaggtggtatcgtgcccctgagatcatgctcaactggatgcac
tacaacgtgacggtggacatttggtcagtgggctgcatcatggctgagctgctgacgggc
aggactctgttccctggcaccgatcatataaaccagcttcagcagataatgcgacttaca
ggaactcctccttcctctctaataagcaggatgcctagccatgaggctcgtacttacatc
agctcacttcctcagatgcccaagaggaattttgcagatgtgtttatcggggcaaatcca
caagctgtggacctcttggagaaaatgctggttttggacactgataagcggattacagca
gcagaggctctggcacatccatactttgcccaatatcatgacccggatgatgaacccgaa
gcagagccttttgaccagagctttgagagccgagagctggatattgaggagtggaaacgt
cagacatacgaggagatgatcagttttgagcctccagtctttgatgtggatgaaatggag
tcttga

DBGET integrated database retrieval system