KEGG   Danio rerio (zebrafish): 678520
Entry
678520            CDS       T01004                                 

Gene name
polh
Definition
(RefSeq) DNA polymerase eta
  KO
K03509  DNA polymerase eta [EC:2.7.7.7]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    678520 (polh)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dre03400]
    678520 (polh)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     678520 (polh)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    678520 (polh)
SSDB
Motif
Pfam: IMS IMS_C zf_UBZ IMS_HHH
Other DBs
NCBI-GeneID: 678520
NCBI-ProteinID: NP_001035337
ZFIN: ZDB-GENE-060421-4949
Ensembl: ENSDARG00000070231
Vega: OTTDARG00000022704
UniProt: F1Q7Z9
Position
13
AA seq 749 aa
MDFGKERVVALVDMDCFYVQVEQRLKPELKNKPCVVAQYKTWKGGGIIAVSYEARAHGVG
RNMFADDARKLCPDLQVARVPEAHGKADLTHYREASVEVIEVMSRFAVIERASIDEAYMD
LTASVQERLKNTSVQDITAQQLKNTHIQGFPTQQENTHLDRDAQRAAGLQQWLDLLSSST
ESSPADLRLAVGALIVEQMRAAVEEHTGFRCSAGISHNKVLAKLACGLNKPNRQTVLPLS
SVPQLFSTLPISKIRNLGGKLGSSITETLSVENMGDLTRFSRAQLEQHFGDKTGPWLYDL
CRGIEFEPVKPRQLPKSIGCSKNFAGKTCLRTKQQVQYWLHQLALELEERLNKDRDVNGR
VARQLTVGVRQAGGQRSGSFSRCCALVRYDAMKMTNDSLTIIKSLNTAGAHQEAWSPALT
LLHLSASKFSDAPSSSSAGITGFLSSDAASSPSQSSSSQRSPMERPAQKRKRQQDQRQRE
NTTSISAFFQRKSLEKQEIQNSLCPGDQSTSASGEHACGDTAAQKTTAISTFLQRESLEK
QEIQNVSLDDEDQSVCAPEENTCREKPAGISTSLQMKSLEKHQIQNSLCVGDQSVRAPGE
NPPREQTSDESPAGISSFFQMKSLEKHRIQNSPCTGDPNIRAPAENTSRDQTSERSTSGM
SGCFQQAVAPAGERVCSPAEEDLQVCERCGMKVLVWEFPEHADYHFALDLQKSFSSGSPS
QMKTPSGSQAKRARVQEPRGTLHSFFKKT
NT seq 2250 nt   +upstreamnt  +downstreamnt
atggatttcgggaaggagcgagtggtcgcgctggtggacatggactgcttctatgtgcag
gtggagcagagactgaagcccgagctgaagaacaaaccctgcgttgtggcgcagtacaag
acctggaaaggcggaggcattatagcggtgagttacgaggccagagctcatggagtcggc
aggaacatgttcgcggatgatgccagaaagctgtgtccagatctgcaggtggctcgggtc
ccagaggctcacgggaaggcggatctcacacactacagggaggcgagtgtggaggtgatc
gaggtgatgtcccgcttcgctgtgatcgagagagccagcattgacgaggcctatatggac
ctgacggccagcgttcaggagcgcctgaagaacaccagtgtgcaggacatcacggcgcag
cagctgaagaacacacacattcagggtttccctacacagcaggagaacacacacctggac
agagatgcgcagcgggccgcaggtctgcagcagtggctggatcttctgtcctccagcact
gaatcttcacctgcggatctgcgtctggccgtcggggctctgatagtggagcagatgagg
gctgctgtggaggaacacaccgggtttcgctgctccgccggtatctcacacaacaaggtg
ttggccaagctggcatgcggactaaacaaacccaatcgccaaaccgtgttgccgctgagc
tccgttcctcaactcttcagcactcttcccatcagcaaaattcgtaatctgggagggaag
ctgggctcgtccatcacggagactctgagtgtggagaacatgggagatctgacccggttc
agcagagcccagctggagcagcacttcggggacaagaccgggccgtggctctatgatctg
tgtcgagggattgagtttgagccggtgaagcctcgtcagctgcccaaatccatcggctgc
agcaagaacttcgctgggaaaacctgcctgcgcacaaaacaacaggttcagtactggctc
catcagctggctctagagttagaggagagactcaataaagacagagatgtgaacggtcga
gtggcccggcagctgacggtgggtgtgcgtcaggctggaggtcagaggtcaggcagtttc
tcgcgctgctgtgctctcgtgcgctatgatgcgatgaagatgaccaacgacagcctgacc
atcatcaagagcctgaacactgctggagcacaccaggaggcctggtctccagcgctgact
cttctccatctgtccgccagtaagttcagcgacgctccctcatcctcatctgcaggaata
accggcttcctgagcagcgacgcggcttcatctccatcacagagctccagcagccagcgg
agcccgatggagagaccagcgcagaagaggaaacgacagcaggaccagcgccagcgcgag
aacaccactagtatatccgcattcttccagaggaagagcctggagaaacaggagatccag
aactctctctgccctggagatcagagcacgagtgcttcaggagaacatgcatgcggagat
acagccgctcagaaaaccacagcaatctccacattcctccagagagagagcctggagaaa
caggagatccagaacgtcagcctcgatgatgaagaccagagcgtttgtgctccagaagaa
aacacatgcagggagaaacctgcaggaatctccacgtccctccagatgaagagtctggag
aaacaccagatccagaactctctctgtgttggagatcagagcgttcgggctccaggagaa
aacccacccagagagcaaacctctgatgaaagccctgcaggaatctcctcgttcttccag
atgaagagtctggagaagcacaggatccagaactctccctgcactggagatcctaacatc
cgtgctccagcagaaaacacatccagagaccaaacgtctgagagaagcacgtcaggaatg
tccggctgtttccagcaggctgtggctcctgcaggcgagcgtgtgtgttctccagcagag
gaggatctgcaggtgtgcgagcgctgcgggatgaaggtgctggtctgggagtttccagaa
cacgctgattatcacttcgctctggacctgcagaagtccttctcttcggggtctccgagc
cagatgaagaccccgagcggctcgcaggctaaaagagcccgagttcaggaaccccgcggc
acgctgcacagcttcttcaagaagacctga

DBGET integrated database retrieval system