KEGG   Danio rerio (zebrafish): 678545
Entry
678545            CDS       T01004                                 

Gene name
gmpr2
Definition
(RefSeq) GMP reductase 2
  KO
K00364  GMP reductase [EC:1.7.1.7]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    678545 (gmpr2)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.7  GMP reductase
     678545 (gmpr2)
SSDB
Motif
Pfam: IMPDH FMN_dh dCache_3 Aldolase
Other DBs
NCBI-GeneID: 678545
NCBI-ProteinID: NP_001035394
ZFIN: ZDB-GENE-030131-1238
Ensembl: ENSDARG00000061301
Vega: OTTDARG00000043721
UniProt: Q1RLT1
Position
7
AA seq 348 aa
MPRIENDIKLDFKDVLLRPKRSTLKSRSEVDLMRSFTFRNSKGSYRGIPIVAANMDTVGT
FEMALALHQFSLFTAMQKHYGVDDWKEFAAKHPECLESVAVSTGTSEGDFEKLGAIVAAV
PQIRYICVDVANGYSEHFVNFVKDVRQKFPTHTIMAGNVVTGEMVEELILAGADIIKVGI
GPGSVCTTRKKTGVGYPQLSAVIECADAAHGLGGHIISDGGCTCPGDVSKAFGAGADFVM
LGGMLAGHCESGGEVIEKNGKKYKLFYGMSSDTAMKKHAGGVAEYRASEGKTVEVPYKGP
VDVTLRDVLGGVRSTCTYVGAAKLKELSRRTTFIRVTQQLNTVFGNDN
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgcctcgcattgaaaatgacatcaaacttgacttcaaggatgtgctgcttcgacccaag
aggagcactctcaaatctcgcagtgaggtggatctcatgcgcagttttacatttagaaac
tcaaagggcagttatcgtgggattcccattgttgctgccaacatggacacagtggggacg
tttgaaatggccttagctttacatcagtttagcctctttacagccatgcaaaagcattac
ggtgttgacgactggaaggaatttgcagccaagcacccagaatgcttagagagtgttgca
gtcagcacagggacgagtgaaggggactttgagaaactgggggccattgttgccgctgtg
cctcagattcggtacatttgtgtggatgtagccaatggctactctgagcactttgtcaac
tttgtaaaagacgtgaggcaaaagttccccacgcacactatcatggctggcaacgtggtc
acgggagagatggtcgaagagctgattcttgctggggctgacattatcaaagtgggcatt
ggaccaggctctgtgtgcaccactcgtaagaagaccggtgtgggttatcctcagctaagc
gccgtcatcgagtgtgctgatgctgcacacggcctgggtggacacatcatatctgatggg
ggatgtacctgcccaggtgatgtctccaaggcttttggggcgggagctgattttgtgatg
cttggaggaatgctggctggtcattgtgagagtggaggtgaagtcatagagaaaaatggc
aagaaatacaagctgttctatggcatgagctcagacacggccatgaagaagcacgcagga
ggcgtagcagagtacagggcatctgagggtaaaacagttgaagtgccttataaagggccc
gtggacgtgacgctgagagacgttctgggtggagttcgctccacctgcacttatgtgggc
gctgctaagctgaaagagttgagccgtcgtaccaccttcattagggtgacccagcagctc
aacacagtgttcggtaatgataattga

DBGET integrated database retrieval system