KEGG   Danio rerio (zebrafish): 678611
Entry
678611            CDS       T01004                                 

Gene name
krt93
Definition
(RefSeq) keratin 93
  KO
K07604  type I keratin, acidic
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dre04812]
    678611 (krt93)
   04147 Exosome [BR:dre04147]
    678611 (krt93)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     678611 (krt93)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   678611 (krt93)
  Exosomal proteins of other body fluids (saliva and urine)
   678611 (krt93)
  Exosomal proteins of colorectal cancer cells
   678611 (krt93)
  Exosomal proteins of melanoma cells
   678611 (krt93)
Motif
Pfam: Filament TolA_bind_tri DUF6236 APG6_N
Other DBs
NCBI-GeneID: 678611
NCBI-ProteinID: NP_001035449
ZFIN: ZDB-GENE-060421-4592
Ensembl: ENSDARG00000044976
Vega: OTTDARG00000042151
UniProt: Q1RLR3
Position
11
AA seq 462 aa
MSLSVRSTTTKGPKTVTSKSIVTKSRGGSTSFPHKAYSVYGGGFGGSTRISSTRIGGGGG
YGFAGGHCGGYGGGYGGGYSGPLSICVMPSSGLGDFQLNEKATMQNLNDRLASYLDKVRS
LEAANATLERQIREYYEKKGPVAQRDYSQYWNTIKDLKDKIKNATTHNANILLQIDNSKL
AADDFRLKFEHEVVMRQCVESDIANLRRLLDQTNLAKNDLQMQIKGLEEELVFLKKNHQE
EMAALRCQLTGTVNVEVDAAPQQDLNKVLEEIRTHYENIIQKHRREQEAWFKDKTAPLNK
EVAHSTETIQTSRSQITELRNTLQSLEIELQSQLSMKAALEHSLAETEARYSAMLAGFQN
QINNLEAELAQLRASIEQQGRDYALLLDIKTRLEQEIATYRNLLENQDIRTQIPVSISVS
GGSQSVSSGGSHSVSSGGSHTISTGGPTIQIKQTTTTSHRTY
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtcactctctgttcgctcaacaacaaccaaaggtcccaagaccgtgacctcaaaatct
atagtcactaagagtcgtggaggttcgacatcctttccacataaagcctacagtgtgtat
ggaggtggttttggaggaagcactcgcatctcctctactagaattggaggcggtggagga
tacggatttgctggaggacactgtggaggatatggaggaggttacggtggaggatatagt
ggaccactttccatttgcgtaatgccttctagcggccttggggatttccagctgaatgag
aaggccactatgcagaacctgaatgatcgtctggcgtcctacctggataaggtgcgctcc
ctagaggctgccaatgccactctggagaggcagatccgcgagtactatgagaagaagggg
ccagtcgcacagagggactacagccaatactggaacaccatcaaggacctaaaagacaag
attaaaaatgcaaccacgcacaacgccaacattctcctgcagatcgacaactctaaactg
gctgctgatgacttcaggctgaaattcgagcatgaggttgtgatgcgccagtgtgtagaa
tctgacatcgctaacctgcgccgcttgctggaccagacgaacctggcaaagaatgaccta
cagatgcagatcaagggtctggaggaagagctggtatttttgaagaagaaccaccaagag
gagatggctgcactgaggtgtcagctgacaggcacggtgaacgtcgaggtcgatgctgct
cctcaacaagatctgaacaaggttctggaggagattcgtactcattacgagaacattatt
cagaaacaccgcagggaacaggaagcctggtttaaagacaagacggcaccattgaacaaa
gaggtggctcacagtacagagaccatccaaacatccaggtcacagatcacagagctgcga
aacacattgcagagtttggagatcgagctacagtctcagctcagcatgaaagcagcactg
gagcactcactggcagaaacagaagctaggtacagtgctatgctagcaggcttccaaaat
caaatcaacaacctggaagctgagttggctcagttgagagctagcattgaacagcagggc
cgagactacgccttgttgctggacatcaagactcgtctggagcaggagatcgccacctac
aggaaccttctggaaaaccaggacattaggactcaaattccagtgtccatctctgtctca
ggtggctctcagtccgtctcatcaggtggatctcactctgtttcctctggaggttcccac
actatctccactggtggaccaacaatccaaataaagcaaacaaccaccacttcacaccgt
acttattaa

DBGET integrated database retrieval system