KEGG   Danio rerio (zebrafish): 692273
Entry
692273            CDS       T01004                                 
Symbol
cadm3
Name
(RefSeq) cell adhesion molecule 3
  KO
K06780  cell adhesion molecule 3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    692273 (cadm3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:dre04515]
    692273 (cadm3)
Cell adhesion molecules [BR:dre04515]
 Immunoglobulin superfamily
  Necl family
   692273 (cadm3)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set C2-set_2 V-set ig C1-set Syndecan He_PIG
Other DBs
NCBI-GeneID: 692273
NCBI-ProteinID: NP_001038711
ZFIN: ZDB-GENE-060512-196
Ensembl: ENSDARG00000057013
UniProt: Q1JPT9
Position
2:complement(44047982..44183613)
AA seq 410 aa
MRARRTLAFPSFQRAALRALAAFTMILATSVRSNYVYDDDPFQPVTQDETVAVGGVVTLT
CGVKENDNSSLQWSNTAQQTLYFGEKRALRDNRIQLVKSTATELIITIGDVQLSDDGEYT
CSIFTMPVRTARATVTVLGVPGKPVITGFEGAVQEGGKVTLTCTSSGGKPPAKLHWYRDH
VEIQGRPDVVESNPNEPTYTVTSELTLSVSRDDNDALIACAVDHPSIANGDKRTEQPLNV
LFSPRVSIHPESDLPREGEKFYLQCVGNGNPEPNAFVWRRKEGELPPLAKVDGAFLRSES
LNKSDNGVYECQADNGIGMGDVAHTLLVQDPTAMSTGSGVDHAVIGGVVAVIVFIMLCLL
LVLGRYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGHSGVDDKKEYFI
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgcgcgcgcgtcggactctggcattcccgtcattccagcgggcagctctccgggcgctc
gcggccttcacgatgattctcgcgacctccgtgcgaagcaactacgtttatgatgatgac
ccctttcagccggtgacccaagatgagacggtggcagtgggcggggtggtaaccctgacc
tgcggcgtgaaggaaaatgataactcctccctccagtggtccaacacggcccagcagacc
ctgtacttcggagagaaaagagcactgagagataaccgtatccagttggtaaagtccacg
gccacggagctgataatcaccatcggggatgttcagctgtcagatgatggagaatatacc
tgttccatttttaccatgcctgtacggaccgcacgagccacagttactgtactcggtgtt
ccaggtaagccggtgataacaggttttgaaggtgctgttcaggagggtggcaaggtaact
cttacctgcacgagttcaggcggcaaacctcctgccaaactacactggtaccgtgaccat
gtggagattcaagggcgtcctgatgtcgtggagtccaatcctaatgaaccgacctacaca
gtgactagcgaactcacgctgtctgtcagcagagacgacaacgatgctctgatcgcctgc
gccgtggaccatccatccatcgccaatggagacaagaggacagagcagcccctcaacgtc
ctcttttcaccaagagtgtcgattcatcctgagagtgacctgcccagagaaggagagaag
ttttacctgcagtgtgtggggaacggaaatccagagccgaatgcgtttgtgtggcggagg
aaagagggagagctccccccgctggccaaggtggatggtgcgttcctgcgatccgagtcc
ctcaacaagtcggataacggcgtttacgagtgccaggctgataatgggattggcatgggg
gacgtagcacacaccctcctggtacaagaccctacagcgatgtccactggttcgggagtc
gaccatgctgtgattggtggagtggtcgctgtcattgtcttcatcatgctctgtctcctc
cttgtcctcggcagatacctcatcagacacaaaggtacgtacctgactcatgaggcaaag
ggatcagacgatgctccggatgcagacacggccatcattaacgctgagggaggccactcc
ggggtggatgacaagaaagagtacttcatctag

DBGET integrated database retrieval system