KEGG   Danio rerio (zebrafish): 751093
Entry
751093            CDS       T01004                                 

Gene name
mif
Definition
(RefSeq) macrophage migration inhibitory factor
  KO
K07253  phenylpyruvate tautomerase [EC:5.3.2.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00350  Tyrosine metabolism
dre00360  Phenylalanine metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    751093 (mif)
   00360 Phenylalanine metabolism
    751093 (mif)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    751093 (mif)
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.1  phenylpyruvate tautomerase
     751093 (mif)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   751093 (mif)
SSDB
Motif
Pfam: MIF Tautomerase
Other DBs
NCBI-GeneID: 751093
NCBI-ProteinID: NP_001036786
ZFIN: ZDB-GENE-080708-1
Ensembl: ENSDARG00000071336
Vega: OTTDARG00000034931
UniProt: Q0ZBR7
Position
14
AA seq 115 aa
MPMFVVNTNVAKDSVPAELLSEATQELAKAMGKPQQYIAVQVVPDQMMMFGGKGDPCALC
SLTSIGKISGAQNKQYSKLLMGLLNKHLGVSADRIYINFVDMDPANVAWNNSTFG
NT seq 348 nt   +upstreamnt  +downstreamnt
atgccgatgtttgtagtgaacacaaatgttgctaaagactcggttccggcggagctgctg
tcggaggccacgcaggagctcgccaaagccatgggcaaaccccagcagtacatcgccgta
caggttgtgccggatcagatgatgatgttcgggggaaaaggagacccgtgtgcgctctgc
tcgctcaccagcatcgggaagatcagcggcgcgcagaataaacaatactccaaactcctc
atgggtttactcaacaaacacctcggcgtttctgctgacaggatctatataaactttgtt
gacatggatccagccaatgtggcctggaacaacagcacctttggataa

DBGET integrated database retrieval system