KEGG   Danio rerio (zebrafish): 767661Help
Entry
767661            CDS       T01004                                 

Gene name
blvra
Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00860  Porphyrin and chlorophyll metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    767661 (blvra)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     767661 (blvra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 767661
NCBI-ProteinID: NP_001070069
ZFIN: ZDB-GENE-060929-312
Ensembl: ENSDARG00000059857
Vega: OTTDARG00000024513
UniProt: Q08CI5
Position
2
AA seq 292 aa AA seqDB search
MLGSVVVGIGIAGSVRMRDLMAPLSSSAAEQISIRGFVSRRSLEDQQGVKQISMTEALSR
DDIHVAFICTENTSHEENIRQFLEAGKHVCVEYPMTLSHTSAVDLWNLAQQKGLVLHEEH
IELFTPDFKQLKKDISGKTLEEGKLHFTGGPLKANFGFPSFSGIARLTWLVVLFGELTVT
SVDLVEEKENKYMKMTAHLLTQQHKPLTWIEERGPGLGRAKHVEFRFQDVTITELPAGQR
EPVGLFMQDLLLFCRKLQGEVSAAELQAERNRILHCLELADRIQQITENTHA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgctgggatcagtggttgttggaattggaattgcaggatctgtgaggatgagagattta
atggctcctctctcgtccagcgccgcggaacagatcagcatcaggggctttgtgtccagg
aggagtcttgaagatcagcagggtgtgaagcagatcagcatgactgaagcgctgagcaga
gacgacatccatgtggcatttatatgcacagaaaacaccagccatgaagagaacatcagg
cagtttctggaggcaggaaagcatgtgtgtgtggagtatcccatgaccctcagccacacc
tctgctgtggatctgtggaatctggctcaacagaagggtctggtgcttcatgaggaacac
atcgagctgttcactcctgacttcaaacagctgaaaaaagacatttctggaaaaacactg
gaggaaggaaagctgcacttcaccggtggtcctctaaaggcaaactttggcttcccgtct
ttcagtggtatcgccagactgacgtggctggtggttctgtttggagagctcacagtcact
tcagtagatctggtggaggagaaagagaacaagtacatgaagatgacggcacacttactg
actcaacagcacaagcctctgacgtggattgaagaacggggtccgggtctgggcagagcc
aaacacgtggagtttcgctttcaggatgtgacgatcacagagcttccagcaggtcagcgt
gagccggtcggactcttcatgcaggatctgctgctgttctgccggaagctgcagggggaa
gtttcagctgcagagctccaggcggagagaaacaggatcttacactgtctggagctagca
gaccgcattcagcagatcaccgaaaacactcacgcctga

DBGET integrated database retrieval system