KEGG   Danio rerio (zebrafish): 767741
Entry
767741            CDS       T01004                                 

Gene name
zgc:152891
Definition
(RefSeq) uncharacterized protein LOC767741
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 767741
NCBI-ProteinID: NP_001070178
ZFIN: ZDB-GENE-061013-229
Ensembl: ENSDARG00000016789
Vega: OTTDARG00000028364
UniProt: Q08BZ2 F1QKM3
Position
21
AA seq 663 aa
MGGFHVTVRTSAFPVSGTYSSVWISLIGSLCESPPIKVEHRLLPGSACTVVIMPEEEVGI
LVLVKLRLEAKPGFPDLDWHCQDVQVKQSSEDPEMEVFPCNKWIRTADGHIILHNDKVCL
KKEETLEVLTNHREKDLQCKQQIIKWGTFAEGSPHCIAMTSVADLGPNLSYIRKRPVTNV
HYIKGFIERRTSWRSLQELETVFLFSGSENMIAKYVQAHWQEDAFFGYQCLNGCNPLCVR
QIHHLPPNFSVTSEMLKSFLPEGSSLDQEMEKGRVYLLDYEVLDQLPANTVNGKQTYLSA
PLCLLHYNQDEELKPIAIQLQQVPGPQNPIFLPSDAPPDWLLAKMWVRNSDFQIHQLLSH
FFRTHLLGEVCCTATLRQLPEIHPLFQLLMPHIRSTLQINIQARATLLAANGVFDKSVAC
GLEAIPQLFTRATQRLRYSSLCVPDDVKERGLDALPVCYYAQDALRVWDALHRFVAGWTR
LYYCSDEDVQSDCELQNWIGEIFREGFLGLTHLGVPQSFQTAAEMCKFVTMVIFSCSALH
SAVNFSQLDFNLCIPNTPATMSRPPSQTKGSVSEEDLLSFLPEVNSSCHVLSVLSLLSQP
AIDFVPLCHYNEWYFHSGAMAKLVEDVQKELKIIAKDIADRNSQLELPYPYMSPDYIENS
VTI
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgggtggctttcatgtgaccgttcgaacctcagcattccctgtctcaggaacgtatagc
agtgtttggatttctttgattggttctctgtgcgaaagtcctccaatcaaagtggaacac
cgtctccttcccggatcggcctgtacagttgtcataatgccagaagaggaagttggcatt
ttggttttggtgaaactccgccttgaggctaagcctgggtttccagacttggattggcac
tgccaggatgtgcaggtgaaacagagttccgaagatccagagatggaggtttttccctgc
aataaatggatccgaacagcagatggtcacattatacttcataatgacaaagtgtgcttg
aaaaaggaggaaacattagaagtcttaaccaatcacagggagaaggatctccaatgtaaa
caacaaattatcaaatggggtacatttgctgaaggtagtcctcactgtatagccatgacc
agcgtggctgatctaggacctaatttgagttacatccggaaacgcccagttaccaatgtt
cactacattaagggatttattgagagaagaacatcctggagaagcctacaggaactggag
acagtcttcctttttagtggaagcgagaacatgattgccaaatatgttcaggctcactgg
caggaggacgcattttttggatatcagtgcctcaatggctgcaatcctctgtgtgtcaga
cagatccaccatctgccacctaacttttcggtcacttcagaaatgctgaaatcttttctg
ccagagggctcatcgctggatcaagagatggagaaaggacgtgtgtatcttctggattat
gaagtgctggatcagctgcctgctaacaccgtcaatggcaaacagacttatttgtctgct
cctttgtgtctgctgcattacaaccaagatgaagaactaaaacctattgctatacaactt
cagcaggttcctggtccacagaatcctattttcttgccgtctgatgccccaccagactgg
ttgttagcaaagatgtgggtccgtaattcagattttcagattcatcagctactttcgcat
ttctttcggactcatcttttaggagaagtgtgctgtacggccacgctcaggcagctgcca
gagattcatcctctatttcagctcttaatgcctcatatccgcagcactcttcagattaac
attcaggctagagcgacacttctagctgcaaatggtgtttttgacaagtcagtggcctgc
ggtctggaggcaataccacagctttttactcgagcgacccagcgtctccgctacagctct
ctgtgtgtgccagatgatgtgaaagagcgaggcctggatgctctgccggtctgttattat
gctcaagatgctctcagagtctgggatgctttacacaggtttgttgcaggctggactcgc
ttgtattactgcagcgatgaagacgtccagagtgactgtgagctgcagaactggattgga
gagatcttcagggagggtttcctcggcctcactcacttaggagtcccacaatcctttcag
acggcagctgaaatgtgcaagtttgttacgatggtgatcttctcctgctcagcacttcat
tcagccgtgaacttctctcagctggattttaacctttgcataccaaacactccagcgacc
atgtctcgtcccccatctcaaaccaaaggctcagtgtccgaggaggatcttttgtccttt
ctaccagaggtcaactcctcctgccacgtccttagcgtcctgtctcttctgtcacagcct
gctattgactttgtacccttgtgccattataatgagtggtactttcacagtggtgcaatg
gccaagcttgtggaggacgtccagaaagagctgaagattatagcgaaagacattgcagac
aggaacagccagctggagttgccctatccttacatgtctccagactacatcgagaacagt
gtgacgatttga

DBGET integrated database retrieval system