KEGG   Danio rerio (zebrafish): 767749
Entry
767749            CDS       T01004                                 

Gene name
adam28
Definition
(RefSeq) disintegrin and metalloproteinase domain-containing protein 28 precursor
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Reprolysin Pep_M12B_propep Reprolysin_5 Reprolysin_3 Rep_3 Reprolysin_4
Other DBs
NCBI-GeneID: 767749
NCBI-ProteinID: NP_001070186
ZFIN: ZDB-GENE-060929-532
Ensembl: ENSDARG00000035514
UniProt: Q08C21
Position
5
AA seq 293 aa
MAQRHLMLWIFTLCVSLDPSVGHIHELHRKVYEIVRPIGLHDLQKRDLQSRPDRVKYAMT
LGGRDIEMHLQKNTGMLTKDYSETYYTEDGMLVTTTPADLDLCYYHGKILNDSASLVSMS
TCDGLRGYFQTAEQRVLIEPLSEDSDGDHAAFKYEDVNEATPRVCGVTNTTWDESGDGVP
PRILKTRSRSSGPTLFQRQKYNEFFLVADNREYKKLNSDLEKLRKRIFEIINFINNVYKE
INTFVALTGFEVWTDNDKITVSAASGATLDSFTKWRNSDLIKRQRHDNAHLLT
NT seq 882 nt   +upstreamnt  +downstreamnt
atggcccaaagacatctgatgttgtggatcttcactctgtgtgtttcactggatccctca
gttggtcacattcacgaactacatcgcaaggtttatgagattgtacgaccaataggatta
catgatctgcaaaaaagagacttacagtcaagaccggatagagtgaaatatgctatgaca
ctgggtggtagagacattgaaatgcatctccagaaaaacactggcatgctgactaaagac
tacagcgagacctactacaccgaagatggcatgcttgtcacaactacaccggcggatttg
gatttatgctactatcatgggaaaatattaaatgacagtgcctctttggttagcatgagc
acctgtgatggactgcgaggctatttccaaacagcagagcagagggttctgatcgagccg
ttgtctgaggatagcgatggcgaccatgccgccttcaagtatgaagatgtaaatgaagcc
acaccaagggtgtgtggagtcaccaacactacttgggatgagagtggcgatggagttcct
ccccgaatcctcaaaacacgctctcgttcctcagggccaactttattccagagacaaaaa
tacaatgagttcttccttgttgcagacaacagagagtacaagaaactgaacagcgatttg
gagaagctgagaaagaggatatttgagatcatcaacttcatcaataatgtttataaagaa
atcaacacttttgttgctctgactggatttgaagtgtggacagataatgataagataaca
gtgtctgcggcttccggagcaactttggacagctttaccaagtggagaaacagtgacctt
ataaaacggcagcggcacgacaatgcccatctccttacgtaa

DBGET integrated database retrieval system