KEGG   Danio rerio (zebrafish): 767777
Entry
767777            CDS       T01004                                 
Symbol
zgc:152904
Name
(RefSeq) uncharacterized protein LOC767777
  KO
K06491  neural cell adhesion molecule
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    767777 (zgc:152904)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    767777 (zgc:152904)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:dre04515]
    767777 (zgc:152904)
   04090 CD molecules [BR:dre04090]
    767777 (zgc:152904)
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    767777 (zgc:152904)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dre00537]
    767777 (zgc:152904)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    767777 (zgc:152904)
Cell adhesion molecules [BR:dre04515]
 Immunoglobulin superfamily
  NCAM1/2
   767777 (zgc:152904)
CD molecules [BR:dre04090]
 Proteins
  767777 (zgc:152904)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   767777 (zgc:152904)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dre00537]
 Others
  767777 (zgc:152904)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_6 Ig_C17orf99 Izumo-Ig Pur_ac_phosph_N Interfer-bind Egh16-like
Other DBs
NCBI-GeneID: 767777
NCBI-ProteinID: NP_001070212
ZFIN: ZDB-GENE-060929-856
UniProt: Q08CM9
AA seq 809 aa
MSVGESKFFTCTAIGEPVSINWFSPQGERIISNERVIVHTEGVRSRLTIYNAIIENAGIY
RCQAADAKGQSQEATVVLEIYQKLTFREVKTPQEFRQGDDAEVVCDVISSPVPAVSWFYK
NREITSEPNSRFQVLPTNNLQILKVGKADEGAYRCEARVEARGEIDFRDIVVQVNVPPVL
SVPQQSFNATADYQESVTFTCVTSGSPDPQVTWYWKGHAIEHSEQYVLNTMNGGKSTLTV
KNIKQTDGGPYMCRASNKAGSSESQLFLKVFVQPHITQLRNVTAVEGSAAMISCTAEGEP
LPEISWRRASDGHSFTDGEKSKDGRVEVRGRHGKSMLTISGVQLSDWGRFDCEALSRIGG
HQKSMFLDIEYAPKFQTNQSIFYSWEGNPVNISCEVKSNPAATMLWRRERFTISSQGTSN
IRIHSTDGRSLLEVTPVSDRDFGRYNCTARNNIGARYQEFILAQADVPSSPYSVRMTAVS
QRMATVSFMKPDSHGGVPISFYIINYRDTSSAQEWRSARTHGVQTAVVLTSLEPNTTYEV
RVSAVNGKGQGEFSHTESFQTLPIREPSPPTVHGQRGVGKAYRLGLVKQDDGGMPIVEYI
LKYKTDKEEQWMTKLVPGMNDFALLQPLQWNTRYNVEITARNVKGLSEPTYFQFLMPQKP
DITDSLFSGLGVGAVLGVGVCVLLLLLVLLDVSCFFLRQCGLLMCITRKLCSKKTSTSGK
SKELEEGKAAYLVDGSKEPIVKMRTEEERVTNPEDCSPVNEPNETTPLTEPEKLPLKEEN
GKEVLKPDLIEIKVHTDNSIHTKQDDSKA
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgagtgttggagagtctaaattcttcacctgcacagccatcggtgagccggttagcata
aactggttcagtcctcaaggcgagcggatcatctcaaacgagcgagtgattgttcatact
gagggcgttcggtccaggctaaccatctataacgccatcatagagaatgctgggatatac
cgatgccaggctgcggatgctaaaggacagagtcaagaagccacagtggtgctggagatt
taccagaagctgacgttccgcgaggtcaagacgccgcaggagtttcgtcagggtgacgat
gctgaagtggtgtgtgacgtcatcagctctcctgtcccggccgtatcctggttctacaag
aacagggaaatcacatctgagcccaacagcagatttcaggttcttcccaccaataacctg
cagatcctgaaagtgggcaaagcggatgagggagcgtatcgctgtgaggcgcgcgtggag
gctcgaggagaaatcgacttcagggatattgtggtgcaggtgaacgttcctcctgtgctg
tctgtgccgcagcagtccttcaacgccactgcagactaccaagagtccgtcactttcacc
tgcgtcacttctggctcgcccgacccgcaggtcacctggtactggaagggtcatgcgatc
gagcactcggagcagtacgtgttgaacactatgaatggaggtaaaagcacgctcactgtt
aaaaacatcaagcaaacagacggtggaccctacatgtgtcgagccagcaacaaagccggc
agctccgagagccagctcttcctcaaggtgttcgtccagcctcacatcactcagctgagg
aacgtgaccgcagtggagggcagcgcagccatgatctcctgtacagctgaaggagagccg
ctgcccgagatctcctggaggagagccagcgacggacacagcttcacagacggggagaag
agtaaggatgggcgtgtggaagtgcgtggacgccatggaaagtccatgttgaccatcagc
ggggttcagctctcagactggggccgattcgactgtgaagctctcagcaggattggaggc
catcagaagagcatgttcttggacatcgagtatgctccaaagttccagacaaatcaaagc
atcttctactcgtgggagggaaacccggtgaacatcagctgtgaggtgaagtctaatcct
gcggcgacgatgctgtggagacgagagcgcttcaccatctccagccaaggcaccagcaac
atccgcatccacagcacagacggacgctcactgctggaggtcactccagtgtccgacagg
gattttggacgctacaactgcactgccagaaacaacatcggcgctcgataccaagagttt
atactagcacaggcagacgtgccgtcgagtccatattctgtccgcatgacggcggtctcc
cagcgtatggccaccgtctccttcatgaagccggattctcacggcggagtccccatcagc
ttctacatcatcaactacagagacaccagcagcgctcaggagtggaggagcgcccgaacg
catggcgtacagactgcagtagttctgaccagtctggagcccaacaccacgtatgaggtg
cgagtgtctgcggtcaatggaaagggtcagggggaattcagccacacagaaagcttccag
acgctgcccatccgtgagcccagtccaccaacggtgcacggccagagaggcgtggggaag
gcctacagactgggcctggtgaagcaggatgacggagggatgcccatcgttgagtacatc
ctcaagtataaaaccgataaagaggagcagtggatgaccaagctggttccgggtatgaat
gattttgcgctcctgcagccgcttcagtggaacaccagatataatgtggagatcacagcg
cgcaacgtcaagggtctgtcagagcccacgtacttccagttcctcatgccgcagaagcct
gatatcacagactctctgttcagtgggctgggtgtgggcgctgtgctaggtgtgggtgtg
tgcgttctcctcctcctgctggtgctgctggacgtcagctgcttcttcctgcgccagtgc
ggcctcctcatgtgcatcacgcgcaaactctgcagcaagaagaccagcaccagcggcaag
agcaaagagctggaggagggcaaggctgcgtatctggttgatggctcaaaggagcccatc
gtgaagatgagaacagaagaagagagagttactaacccggaggactgcagtccagtgaat
gaacccaatgagacgactcctctgaccgagcccgagaagctgccgctgaaggaggaaaac
ggcaaagaagtgctgaagccggatctgattgagattaaagtccacacggacaacagcatc
cacacaaaacaggacgacagcaaagcgtaa

DBGET integrated database retrieval system