KEGG   Danio rerio (zebrafish): 768133
Entry
768133            CDS       T01004                                 

Gene name
ezh2
Definition
(RefSeq) histone-lysine N-methyltransferase EZH2
  KO
K11430  [histone H3]-lysine27 N-trimethyltransferase EZH2 [EC:2.1.1.356]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00310  Lysine degradation
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    768133 (ezh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    768133 (ezh2)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.356  [histone H3]-lysine27 N-trimethyltransferase
     768133 (ezh2)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     768133 (ezh2)
   Polycomb group proteins
    PRC2-EZH2 complex
     768133 (ezh2)
SSDB
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC Nop
Other DBs
NCBI-GeneID: 768133
NCBI-ProteinID: NP_001070747
ZFIN: ZDB-GENE-041111-259
Ensembl: ENSDARG00000010571
Vega: OTTDARG00000021405
UniProt: Q08BS4
Position
24
AA seq 760 aa
MGLTGRKSEKGPVCWRRRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTDILNQEW
KLRRIQPVHIMTPVSSLRGTRECTVDSGFSEFSRQVIPLKTLNAVASVPVMYSWSPLQQN
FMVEDETVLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALN
QYSDNEEDDEEDDHHDYKFEKMDLCDGKDDAEDHKEQLSSESHNNDGSKKFPSDKIFEAI
SSMFPDKGSTEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHPFQATPNTYKRKNMENLVDSKPCGIYCYMYMVQDGMVREYPAGVVPERAK
TPSKRSTGRRRGRLPNSNSRPSTPTVNSETKDTDSDREGGADGNDSNDKDDDDKKDETTS
SSEANSRCQTPVKLKLSSEPPENVDWSGAEASLFRVLIGTYYDNFCAIARLIGTKTCRQV
YEFRVKESSIIARAPAVDENTPQRKKKRKHRLWATHCRKIQLKKDGSSNHVYNYQPCDHP
RQPCDSSCPCVTAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCL
TCGAAEHWDSKNVSCKNCSIQRGAKKHLLLAPSDVAGWGIFIKEPVQKNEFISEYCGEII
SQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDH
RIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgggattgaccgggaggaaatcggagaagggtcctgtttgctggaggcggcgagtgaag
tctgagtacatgcggctgcggcagctcaaacgcttcaggagggcagacgaggtcaagagc
atgttcagctccaacagacaaaaaatactggagcgtactgacatcttaaatcaggaatgg
aaactgaggaggatacagcctgttcatattatgacacctgtgagctccttgcgtggaacc
agagagtgcactgttgacagtggcttttctgagttctccagacaagtcattcccctcaaa
acactgaatgccgtggcctctgttcctgtcatgtactcgtggtctcccctccagcaaaac
tttatggttgaagatgagaccgtattgcacaacatcccatacatgggtgatgaaatcctt
gatcaagacggcaccttcatagaagagctgattaaaaattatgatggaaaagttcatgga
gatcgagagtgtggcttcataaatgacgagatttttgtggagttggtgaatgcactcaat
cagtacagtgataatgaggaagatgatgaagaggatgatcatcatgattataagtttgaa
aagatggacctctgtgatggaaaagatgatgctgaagaccacaaggaacagctgagttct
gagagtcacaacaacgatggatcaaaaaagtttccctctgataaaatctttgaagccata
tcttcgatgtttcctgacaaagggtcaactgaagaactcaaagaaaaatataaagaactc
actgagcagcagctcccaggggctcttcctcctgaatgcacccccaacattgatggacca
aatgccaaatcagtgcaaagagagcagagtctgcactccttccataccctcttctgcagg
cgttgcttcaaatacgattgcttccttcacccttttcaagcaactccaaacacatacaag
cggaagaacatggaaaatctggtggatagcaaaccttgtggcatttattgctacatgtat
atggttcaggatggcatggttagggaatacccagcaggtgtggttcctgaacgtgccaag
accccttcaaagcgcagtacaggccgacgcagaggaaggctcccgaacagcaacagcaga
cccagcacgccaaccgtcaactctgagactaaagacacagacagcgaccgagagggtgga
gcagatggaaacgacagcaatgataaagatgatgatgacaaaaaggatgagaccaccagc
tcttcagaggcaaactctcgctgtcagactccagtgaagctgaagttgagctcagagcct
cctgagaatgtggactggagcggtgcggaggcgtctctgttcagggtgctcatcggcact
tactacgacaacttctgtgctatagccagactcatcggcacaaagacctgtagacaggtt
tatgaattcagggtaaaagaatctagcatcattgcaagagcacctgcagtggacgaaaac
actcctcaaagaaagaagaagaggaaacacagattgtgggctacacattgtcgaaaaatt
caactaaagaaagatggctcctctaatcatgtgtataactaccagccatgtgatcacccg
cgccagccatgtgacagttcttgcccttgtgtcacagcccaaaacttctgtgagaagttc
tgccagtgtagctcagaatgtcagaatcggtttccaggttgccgctgtaaggcccagtgt
aacaccaagcagtgtccgtgttacctggctgtacgagagtgtgaccctgacctgtgcctc
acctgtggggcagctgagcactgggacagtaaaaacgtctcctgcaagaactgtagcatc
cagagaggagcaaagaagcatttgctgctggctccatctgatgtggccgggtggggaatc
ttcatcaaagagccggttcagaagaatgagttcatctcagagtactgcggggagatcatc
tcgcaggatgaggcagatcgcagaggcaaagtctatgacaaatacatgtgcagcttcctc
ttcaaccttaacaacgactttgttgttgatgcgacaaggaaaggaaacaagatcagattt
gccaaccactcggtgaaccccaactgctatgcaaaagtgatgatggttaatggggatcac
aggattggcatatttgcgaagagagccatacagaccggagaggaactcttcttcgactat
agatacagtcaagcggatgctctgaaatatgtaggtattgaacgtgaaatggaaattcca
tga

DBGET integrated database retrieval system