KEGG   Danio rerio (zebrafish): 768147
Entry
768147            CDS       T01004                                 

Gene name
khdrbs2
Definition
(RefSeq) KH domain-containing, RNA-binding, signal transduction-associated protein 2
  KO
K17843  KH domain-containing, RNA-binding, signal transduction-associated protein 2
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dre03041]
    768147 (khdrbs2)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    768147 (khdrbs2)
SSDB
Motif
Pfam: Qua1 Sam68-YY KH_1 STAR_dimer
Other DBs
NCBI-GeneID: 768147
NCBI-ProteinID: NP_001070758
ZFIN: ZDB-GENE-061013-497
Ensembl: ENSDARG00000069469
Vega: OTTDARG00000027822
UniProt: Q08BJ2
Position
13
AA seq 346 aa
MDQDKYLPELVAEKESLDASFVHAMRLLAEEIEKFEGDELRKDGEVKKYLDIISNKNIKL
SERVLIPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSG
EAKYAHLSNDLHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNG
SDDPSRGRSARGRGLRLTSTASPRGRGSAAPPAPPGRGAAAPRGTVSSRTSVPTPARGVS
APRTRGTAGTPGYRAPSLQATHKTYEDYGYDDGYDGEYDDQSYESYDDNYSNQSKSVSEY
YEYGHGNNDENYNNYEEDWISSRPNLKAPASRLTRGGYRDHPYGRY
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggatcaggacaagtacctgccggagctcgtggccgagaaggagagcttggacgcgtcg
ttcgtgcacgcgatgcgccttctggccgaagagattgaaaagtttgaaggcgacgagttg
agaaaagatggcgaggtgaagaaatacctggatatcatcagcaacaaaaacatcaaactg
tccgagcgtgtgctgatcccggttcagcagtatcctaagtttaattttgttgggaaactg
ctggggcccaggggcaattccatgaaaagattacaagaggaaacgggagcaaagatgtcc
atccttggcaagggttcaatgagggataaaggcaaggaagaagagctgaggaaaagtgga
gaggcgaaatacgcccatttgagcaacgatcttcacgttttaattgaggttttcgcacca
cctggagaagcctattcccgcatgagccatgccctggaggagattaagaaattccttgtt
ccagattacaatgatgaaatcaggcaggaacagctccgtgagctctcctacttgaatggc
tcagatgacccaagccgaggaagaagtgcgcggggacgtggattgcggctgacctccaca
gcttcccccagaggtcgaggaagtgcagcaccacccgctccacctggacgaggagcagca
gcccccagaggaactgtgagctcccgcacctccgtccccacaccagccagaggggtgtct
gcaccccgaaccagaggaacagctggaacacctggatacagagccccgtcactgcaagcc
acgcacaagacatatgaagattatggatatgatgatggttatgacggagaatatgatgac
cagagttatgagagctatgatgacaactacagcaaccagtcgaaaagtgtctcggaatat
tatgaatatggacatggcaacaatgacgaaaactacaacaattacgaagaggactggatt
tcatctcgaccaaacctcaaagctccagcatcaagacttactcgagggggatacagagat
cacccctatggtagatattaa

DBGET integrated database retrieval system