KEGG   Danio rerio (zebrafish): 768298Help
Entry
768298            CDS       T01004                                 

Gene name
faah2b
Definition
(RefSeq) fatty-acid amide hydrolase 2-B
  KO
K19176  fatty acid amide hydrolase 2 [EC:3.5.1.99]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    768298 (faah2b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.99  fatty acid amide hydrolase
     768298 (faah2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 768298
NCBI-ProteinID: NP_001070930
ZFIN: ZDB-GENE-061027-358
Ensembl: ENSDARG00000054786
Vega: OTTDARG00000027357
UniProt: Q05AM4 B2GT53
Position
7
AA seq 526 aa AA seqDB search
MGLTLGERVQHCLLVLVSGLFLALFRLLSPGTKRPKHLPPITNPLLTLSAVQLAEKIRRG
EVSSVEVVQAYIDRIQEVNPLLNALIKDRFSAALLEAARADKLIKEENGGEEVLRNQFPL
LGVPMSVKESFGLQGMPNSGGLKSRGKVLASVDAPPVALLKRAGAIPLGVTNTSELCMWM
ESNNHLYGITSNPYNLERICGGSSGGEGSIIGGGASVFGIGSDIGGSIRMPCFFNGIFGH
KPSRGVVSNDNQFPRCSGLQNEYTGSGPMCRYAEDLLPLLKIMAGPTADKLTLSKAVDLK
KLRFFTIVDDGGSPLTSPVDRQLVEVQKRVAARLEADLGVTVQEVNFPQLKYSYQIWDTF
LALPDKDGKPPEAFVELMADGGSVWPVWELIKRIFGRSEHTVAAIGLALMESSHSSKSSE
FILKQKEDLQREMEDLLGTDGVLLYPSHPLLAPKHHHPLFMPFNFSYTGILNILGLPVTQ
CPLGLSKERLPLGVQVVAGLCQDHLTLAMALYLEKAFGGWVDPGVV
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgacactcggggagcgcgtgcagcactgtctgctggtcctcgtgtccggtctg
tttttggctctcttcaggctgctttcacctggcacaaagcgtccaaaacatcttcctcca
atcacaaacccgctgcttactctctctgcagtgcagctggctgagaagatacgcagagga
gaggttagcagtgtggaggttgtgcaggcgtatattgacaggattcaggaagtgaaccca
ctgctcaatgctttgatcaaagacaggttttctgccgcccttctggaggcagctcgtgca
gacaaactaataaaggaggaaaatggaggagaggaagttctgaggaaccagtttcctctg
cttggtgttccaatgtctgtcaaagagtcattcggactacagggcatgcctaattcaggc
gggttgaaatcccggggtaaagtgcttgccagtgtggacgctcctcctgtggctctattg
aagagagctggagcaattcctctcggtgtcaccaacaccagcgagctctgcatgtggatg
gagtccaacaaccatctctacgggatcaccagtaacccctacaaccttgagaggatctgt
ggaggaagctcaggtggagagggaagcatcatcggtggtggtgcgtctgtgtttggtatc
ggctctgacattggaggaagtatccgtatgccgtgttttttcaatgggatttttggacac
aaaccctcaagaggtgttgtctcaaatgacaatcagtttcccagatgttctggtctccag
aatgaatacacaggttctggtccaatgtgtcgctacgctgaagacctgctcccccttctg
aagatcatggctggacccactgcagacaaacttaccctctcaaaagcggtggatctgaaa
aagttgcgtttcttcactatagtagatgatggcggatctcctctgacatctcctgtagac
agacaacttgttgaagttcaaaagcgggttgctgctcgtttagaggcagatctgggagtc
acggttcaggaagttaattttccgcagctcaaatactcttatcagatctgggacacattc
ttggcacttccggacaaagatggcaagcctccagaggcttttgttgagctgatggcagac
ggaggctctgtgtggccggtttgggagctgataaagaggatatttggaagatctgaacac
actgtggctgctatcggtttggcactgatggagagttcccacagctccaagtcatctgag
tttatcctgaaacagaaggaggatctgcagagggagatggaggatctgctagggacagat
ggagtgctgctgtacccctctcaccctcttctcgcacccaaacaccatcatccacttttt
atgccattcaacttcagttacacaggaattttaaacatcctgggcctgccagtgacccag
tgccccctggggttgagtaaggagcgactgcccttgggtgtgcaggtggtggctgggttg
tgtcaagaccatctgaccttagctatggcgctctacctggagaaggcttttggaggctgg
gtcgatcctggagtggtttaa

DBGET integrated database retrieval system