KEGG   Danio rerio (zebrafish): 777756
Entry
777756            CDS       T01004                                 

Gene name
nup98
Definition
(RefSeq) nuclear pore complex protein Nup98-Nup96
  KO
K14297  nuclear pore complex protein Nup98-Nup96
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    777756 (nup98)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dre03019]
    777756 (nup98)
   03036 Chromosome and associated proteins [BR:dre03036]
    777756 (nup98)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     777756 (nup98)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    777756 (nup98)
SSDB
Motif
Pfam: Nup96 Nucleoporin2 Nucleoporin_FG
Other DBs
NCBI-GeneID: 777756
NCBI-ProteinID: NP_956979
ZFIN: ZDB-GENE-040426-1180
Ensembl: ENSDARG00000074955
Vega: OTTDARG00000028386
UniProt: E7F981
Position
21
AA seq 1814 aa
MFNKSFGAPFGGGTGGFGTSSTFGQPNSGFGATPGGFGSSAFGTTNNTGGLFGNTQNKPG
GLFGSSTFSQPVTSSTSSGFGFGATSGTSNSLFGSTNTGGGGLFSQQNNAFGANKPAAFG
NFGTSTSSGGLFGTTNTASNPFGGTSGSLFGSSSFTAAPPGTTIKFNPPTGSDTMVKGGV
TTSINTKHQCITAMKEYENKSLEELRLEDYQAGRKGPSNLPMAAGTGGLFGAAAPATPST
GTGLFGSSAPNTGFNFGQNKTTFGTSTGAFGTTTGSLFAQPQQQQQQQQQNSSLFKPFGS
ATTTQNNTFSFGNTSSMVSSSWCTKGLFANTAASQAGGLFGNTNTSTATGFGTGIFGQTN
TGFGNVGTQNLFGNKPAGFGTTTTSAPSFGSGPGLFANKPTLTLGTNTNTSTFGFSGTGA
GGGLFGNKTAATGLGPVLGAGFGAGVGTGQTSLFGNNQKLGSTLGSVGTFGAGGFNTGAS
TLNFGAPQQPIALTDPSAGAAQQAVLQQQISALAYSPFGDSPLFRNPLSDPKKKEERLKP
TNPAAQKALTTPTQYKLTPRPATRVRPKALSSSGSSKSQLFDGLDDDELSLNNGAFMPRK
SIKKLVLKNLNNSSLYNNSLNREADDLASPSEYPQNGLSLSLDEGEPREANMERRGEDDL
EVSKFYTNPITKPIPHAQLSPLLQDTISEFNMRGSGSHRNGLEASSEDLSLAEDSIQEER
DEELEAQKPPHPAGIVLSRVGYYTIPSMEELGKMLNENGECIVENFTIGRKGYGSVFFPG
EVNLTNMILDEIVHFRRKEIIVYPDDKDKPPVGEGLNRRAEVTLDGVWPNDKTTCCQIKS
PDRLTEMNYEGRLEAASRKQGARFLEYRPETGSWVFEVAHFSKYGLQESDEEEEISPAKL
DLKKLKTAVPPGLAQLPLTQQQGAPQAQSTAVLELLSRVSELDSDMADITQEHPVESILD
DEDGERTSFEENKLRSETPAENEPVSASSQIASSMGINPHTLQIMKASLFADDDECDMFQ
EHVSSKLIQDVASTKLLLSGAGRPSIGALLQNKFTSGGGLFSQLPEVPFSGISQKLNKSL
ASEAAWPSLGPSFLLPPPPPEPTLRTVGARRLGGPVPLEASITLGKGRLLMDAALFRGRS
FRVGWGPNWTLVHSGDQLSVTHPVKEPAAENLGFGFLPKPTKTKPITESPFKVRVEQVVG
LEPKQSSESLSLYLRPLEIGLKHSTINTEEPCPFIQPAGGVDALHGYAEWIVEVNKDIGG
SDAGLAHWKQVWTLCAALWGRLGDRDLDTEQYSDYQQQLERRRSFSHWLSDCAANCIEEE
VGRALQRSHAEAVFSYLTGHCISKACKLSQKSGDHRLSLMLSQAVGSQFCRDLLALQLTD
WNRMQTDSFIEEERLRIFALLAGKPVWQSTDCCINVCSELDWKRCVAVHLWYMLPPTASV
ADALTKYETAFQGSEEVKRYAGPPLPPYIDELELLGLDEDMDEIDSKKPLYDICFHLLKL
YSDRHYSLQQLLDPSTVTADHLDYRLSWHLWSVLQALNYNHLATSCQGLLHASYAAQLES
AGLWEMAIFVLLHITDSGRRESAVREMLSLHCSLEETEESMEKEQFLTEKLLIPIQWIHQ
AKAIRACREGDKHREALHLYKAGHWNHCHRLVIQHLASDCIINDNHKYLLDFLEGLAVPE
RSVQIQGWDTSGRVFLDYIHVIQTLQDIQQMESPGYELERLHTEVTSLCNRIVLLPCSKA
KDKLAQSEMAKRVANILRVVLSLQQGGEGTPDSQYIPLCQLASHIGRLPMPEDYALEELR
SLTNSYMQEYVISH
NT seq 5445 nt   +upstreamnt  +downstreamnt
atgttcaacaaatcttttggtgctccctttgggggaggtacaggaggatttgggacgtca
tcaacttttgggcaaccgaattccgggtttggtgcaacaccagggggctttggatcttca
gcatttgggacaacaaacaacacaggaggactgttcgggaacacccagaacaagcctggt
ggtctctttgggtcaagcacgttcagtcagcctgttacatcctccaccagtagtggcttt
gggtttggtgccaccagcggaacatcaaacagccttttcggaagcaccaacaccggaggt
ggaggactgttttcccagcagaataatgcatttggagccaacaaaccagccgcttttggc
aattttggaacaagcaccagtagtggtggattgtttggaacaaccaacacagcatccaac
ccttttggaggaacatcaggatctttgtttgggtcatcaagtttcaccgctgcacctcct
ggcacaaccattaaattcaatccacctacagggagtgatacaatggtaaaaggaggtgtg
acaaccagcatcaacaccaaacaccagtgcatcactgccatgaaggaatatgaaaacaaa
tctttagaggaattgaggcttgaggattaccaagcaggaaggaagggtccttccaacctc
cccatggcagctggcacaggtggcctctttggagcagcagccccagctactcctagtact
ggcactggactttttggctcctctgctccaaacactggctttaacttcggccaaaacaaa
accacatttggcaccagtacaggcgcctttggtacaaccacaggaagtttgtttgcccag
ccacagcagcagcagcaacaacagcagcaaaattccagtctcttcaaaccattcggctca
gccaccaccacccaaaacaatactttctcctttggcaacaccagcagcatggtaagttcc
agttggtgcactaaagggctgtttgccaacactgctgcctctcaggctggaggactgttt
ggaaacactaacacaagtactgccactggctttggcacaggaatctttggtcagactaac
actggctttgggaatgtaggcacacagaatcttttcggtaataagcctgcaggatttggc
accaccactactagcgcaccctcttttggctcaggccctggtctttttgcaaataagcct
acgctcactcttgggactaacacaaacacctcaacgtttgggttcagtggtactggtgct
ggtggtggcctttttgggaacaaaactgctgcaacaggtcttggaccagtattgggtgct
ggctttggagcaggtgtaggaactggccagacgtcattgtttgggaacaaccagaaactg
ggctccaccttgggctcagtgggcacttttggcgctggaggctttaacactggtgccagc
acactgaattttggcgctcctcaacagcctattgctctgactgaccccagtgcaggagct
gctcagcaggctgtgctccagcagcagatcagtgcgctggcctattcgccttttggagac
tcacctctctttagaaacccactgtcagaccccaaaaagaaggaggagcgtctgaaaccc
acaaatccagctgcccagaaggccttgactacccctactcaatacaaactcacacctcgt
cctgccacccgcgtgcgccccaaagcactctcctcctcaggctcttccaaatctcagctc
tttgatgggcttgatgatgatgagctctctcttaacaacggggctttcatgcctaggaag
agcataaagaagcttgtgttgaagaatctgaacaacagcagtctgtacaacaactcatta
aaccgagaggctgatgatttggcctctccttcagagtacccacagaatgggctcagtctg
agtttggatgaaggagaacccagagaagcaaatatggagagaagaggggaggatgatctg
gaggtctcaaagttttacaccaacccaatcaccaaacccattcctcatgcccagctgagc
cccttgcttcaggacaccatctccgagtttaacatgcggggatctggcagtcatcgcaac
gggctggaggccagcagtgaagacctctctctagcagaggactccattcaggaggagaga
gatgaggagctggaggctcagaaacctcctcacccagctggtatagttcttagccgtgtt
ggctactacaccatcccttcgatggaagagctgggaaagatgctgaatgagaatggggag
tgtattgttgagaacttcaccatcggcagaaaaggctatgggtcagttttcttccctggg
gaagttaatcttaccaacatgatcctggatgagattgtacacttcagacgcaaggagata
atcgtgtaccctgatgacaaagacaagccccctgttggagagggactaaacagacgcgct
gaggtgactctagatggagtgtggcccaatgacaagacaacttgctgtcagatcaagagt
ccagataggctgactgagatgaactatgagggtcggcttgaagcagcttcacgcaaacag
ggcgcccgcttcttggagtaccggcctgaaactggctcttgggtctttgaggtggcccac
ttctcaaagtatggcttgcaggaatctgatgaagaggaggaaatttctccagctaaactc
gacctgaagaagctgaagacagcggttcctccagggcttgcgcagcttcctctgacccag
cagcagggggcgccacaggctcagagtactgcggttcttgagctcctcagccgtgtgtcg
gagttggacagtgacatggctgacattactcaagagcacccggtcgagagtattttggac
gatgaggatggcgaaagaacttctttcgaagagaacaaactgagatccgagacccctgct
gagaacgagcccgtgtctgcatccagccagatcgcttcctctatgggcatcaaccctcat
actttacagattatgaaggcctctctgtttgcagacgacgatgagtgtgacatgtttcaa
gagcatgtttcttcaaagctcattcaagatgtggcttcaaccaaacttttgctttctgga
gctggtcggccatcaattggagcccttttgcaaaacaaatttacttcaggaggaggcctc
ttttcccagttgccagaggttccttttagtggaatttctcagaagttgaacaagtcactg
gcatcagaagctgcatggccatcattgggtccatcttttcttctcccgccccctcctcca
gaacctactcttcgcactgtaggggcccgcaggcttgggggacctgtgcctctggaggcc
tctataactctaggcaaaggtcgcctgcttatggacgcggctctgttcagaggccggtct
ttcagagtgggctggggccccaactggactcttgtgcacagtggagatcaactcagtgtc
acacaccccgtgaaggagccggcagcagagaacctggggtttggattcttacccaaacca
accaaaaccaaaccgatcactgaaagtccctttaaagtgcgtgtggagcaggtggtcggt
ctggagcccaagcagtcatcagagagcctttctttgtacctcaggccactggagatcggt
ctgaagcacagcaccatcaacacagaggagccctgtcccttcatccagccagcaggagga
gtggacgctctgcatggctacgcagagtggattgtagaggtcaacaaagatattggagga
agtgatgctggcctggcgcattggaagcaagtctggactttgtgtgctgctctttggggt
cgactgggtgaccgtgacctggacactgagcaatattcagactaccagcagcagctcgag
aggcggaggagcttctcacactggctgtctgattgcgcggccaactgcatcgaggaggag
gtgggccgagcgcttcagcgcagccatgcagaggccgtattcagttacctcactggccac
tgcatcagcaaggcctgcaaattgtcccagaagagtggggaccatcggctttctctgatg
ctgtcccaggctgtgggctctcagttttgtcgtgatctgttggctctgcagctcacagac
tggaacaggatgcagacagactccttcatcgaggaggagaggctacgaatatttgctttg
cttgcaggcaaaccagtgtggcagtctacagactgttgtataaacgtgtgctcagagctg
gactggaagcggtgtgttgctgttcatctgtggtacatgctgcctcccactgcctctgta
gctgatgctctcaccaaatacgaaacagcgtttcagggttcagaggaagtgaaaaggtat
gctggccctcctttacctccgtatatagacgaactggagttgttgggtttggatgaagac
atggatgagatcgattccaaaaagccactctacgacatctgcttccacctgctcaaactt
tacagcgacaggcactacagccttcaacagctgcttgatcccagcacagtgaccgccgat
catctggactatcggctgagctggcacctctggagtgtgctgcaggctctcaactacaac
cacctggccacctcatgccagggcctgctgcatgccagctatgctgctcagctagagagt
gcgggattatgggaaatggccatctttgtgttgctgcacatcacagactctggacgtaga
gagagtgcagtaagggaaatgcttagcttacattgctccctcgaggagacggaagagtcg
atggagaaggagcagtttcttacagaaaagctgctgatccccatccagtggatccatcaa
gccaaggccatccgtgcctgcagagagggagataaacatagagaagccttgcacctttac
aaggctggccactggaaccactgccatcgactggtcatccagcacctcgcctcagactgc
atcattaacgataatcataagtacctcctggatttcctagagggtttggcagtgccagag
cgcagtgttcagattcagggctgggatacgtctggaagggtcttccttgattacatccat
gttattcaaacgctgcaagacatccagcagatggaaagcccaggttatgagctggagcga
ctgcatacagaggtgacatctctctgcaatagaatagtgcttctcccctgttccaaagct
aaagacaaacttgcccaatcagagatggccaaacgtgtggctaacatcctccgggtggtc
ctgagtctccagcagggtggtgaaggcaccccagactcccaatacatccctctttgtcag
cttgcttcacacattggacgtctgcccatgcctgaggactatgctttggaggagctgcgc
agccttactaactcatacatgcaagagtatgtgatcagtcactga

DBGET integrated database retrieval system