KEGG   Danio rerio (zebrafish): 777766Help
Entry
777766            CDS       T01004                                 

Gene name
ubc
Definition
(RefSeq) polyubiquitin-C
  KO
K08770  ubiquitin C
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    777766 (ubc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dre04121]
    777766 (ubc)
Ubiquitin system [BR:dre04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitins
   777766 (ubc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 Sde2_N_Ubi
Motif
Other DBs
NCBI-GeneID: 777766
NCBI-ProteinID: NP_001071272
ZFIN: ZDB-GENE-061110-88
Ensembl: ENSDARG00000102632
Vega: OTTDARG00000030831
UniProt: F1QHN6
Position
10
AA seq 533 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctttgtgaagacgctgactggtaagaccatcaccctcgaggtcgagcccagc
gacaccattgagaatgtcaaggctaaaattcaagataaggagggcattcctcctgaccag
cagcgtctgatcttcgctggaaaacagttagaggatggacgcaccctgtccgactacaac
atccagaaagagtccaccctccacctggtgctccgcctcaggggtggcatgcagatcttt
gtgaagacgctgaccggcaagaccatcactctagaggtggaaccaagcgacaccattgag
aacgtcaaggctaaaattcaagataaggagggcatcccacctgaccagcagcgtctgatc
tttgctggcaagcagcttgaagatggacgcaccctgtccgactacaacattcagaaagag
tccaccctccacctggtgctgcgtctgagaggcggtatgcagatcttcgtcaagactctg
acaggaaaaaccatcactcttgaggtcgagcccagtgacaccattgagaacgtgaaagcc
aagattcaagataaggagggcatcccacctgaccagcagcgtctgatctttgctggcaaa
cagcttgaagatggacgcaccctgtccgactacaacatccagaaagagtccaccctccat
cttgttctccgcctcaggggcggcatgcagatcttcgtgaagacgctgactggaaaaacc
atcactttggaggtcgagcccagcgacaccattgagaacgtcaaggctaaaattcaagat
aaggagggcatcccacctgaccagcagcgtcttatctttgccggcaagcagcttgaagat
gggcgcaccctgtctgactataacatccagaaggagtccaccctccacctggtgctccgc
ctcaggggtggtatgcagatcttcgtgaagacgctgactggtaagaccatcactcttgag
gtcgagcccagtgacaccattgagaacgtgaaagccaagattcaagataaggagggcatc
ccacctgaccagcagcgtctgatctttgccggcaagcagcttgaagatggacgcaccctg
tccgactataacatccagaaggagtccaccctccatcttgtgctgcgtctgagaggtggt
atgcagatcttcgtcaagaccttaactggcaagaccatcactcttgaggtggaaccaagt
gataccattgagaatgtgaaggcaaaaatccaggacaaggagggcatcccacctgaccag
cagcgtctgattttcgctggcaagcagcttgaagatggacgcaccctgtccgactacaac
atccagaaggagtccaccctccacctggtgctccgcctcaggggcggcatgcagatcttc
gtcaagacgctgactggcaagaccatcacactcgaggtggaaccaagcgacaccattgag
aacgtgaaggccaaaatccaggataaggagggcatcccacctgaccagcagcgtctgatc
ttcgctggcaagcagcttgaagatggacgcactctgtccgactacaacatccagaaggag
tccaccctccacctggtgctgcgtcttcgtggcggcaaataa

DBGET integrated database retrieval system