KEGG   Danio rerio (zebrafish): 777792
Entry
777792            CDS       T01004                                 

Gene name
sult2st3
Definition
(RefSeq) sulfotransferase family 2, cytosolic sulfotransferase 3
  KO
K01015  alcohol sulfotransferase [EC:2.8.2.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    777792 (sult2st3)
Enzymes [BR:dre01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.2  alcohol sulfotransferase
     777792 (sult2st3)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3
Other DBs
NCBI-GeneID: 777792
NCBI-ProteinID: NP_001071636
ZFIN: ZDB-GENE-061117-4
Ensembl: ENSDARG00000028367
Vega: OTTDARG00000027783
UniProt: A4FUP0
Position
16
AA seq 288 aa
MEVSEFNLLYKGFLLPKLAHTEESLQYLENFKVKDDDVFAVTYPKSGTTWMQNILPPLLN
GGDLTPVQTVPNWDRAPWLEEIRAAVVLEERPSPRAIVSHMPYRLMPSSFYKSKAKVIYV
ARNPKDVIVSSYHFHKMASFLEDPGTFDDFVNKFLSGEIVFGKWSDHIKSWRNPELKDRI
LYVTYEEMLQDLRGVLCRMLKFLGRELSTEALDRVVSNSTFKNMKTNKMSNYTMVPQEIM
DNNKSAFLRKGVAGDWKNFFSPELDAKFTAVIREEMKGTNIKFPWDEE
NT seq 867 nt   +upstreamnt  +downstreamnt
atggaggtcagcgaattcaatctgctctacaagggtttcctgctccctaagctcgcacac
acagaggaaagtctgcaatatctcgagaatttcaaagtcaaagatgatgatgtctttgct
gttacctatccaaaatctggtaccacatggatgcaaaatattctccctccgcttctgaat
ggaggagacctgacacctgtgcagactgtcccaaactgggatagggccccatggctggag
gagatacgagctgcggtggtgctcgaagaacgcccttcaccgcgagccatagtctctcac
atgccttaccgcttgatgccttcctctttctacaaatccaaggccaaggtcatctatgtt
gcacggaatcctaaagatgttatagtctcttcttaccactttcacaaaatggccagtttc
cttgaagaccccggaacatttgatgacttcgttaacaaattcctgtcaggagaaattgtt
tttggtaaatggtctgaccacatcaaaagctggcgaaacccagagctcaaagacagaatt
ctgtacgtcacctatgaagaaatgcttcaggaccttcgtggagtcttgtgccggatgtta
aaatttctgggccgggagctcagcacagaagctttggatcgtgtcgtcagtaacagcact
tttaaaaacatgaagacgaacaaaatgtctaactacactatggtgccacaagaaattatg
gacaacaacaagtcagccttcctgaggaaaggtgttgctggagactggaagaatttcttc
agcccggagcttgatgccaagttcacagctgtaattcgggaggaaatgaaaggaactaac
atcaaattcccctgggatgaggaataa

DBGET integrated database retrieval system