KEGG   Danio rerio (zebrafish): 791456
Entry
791456            CDS       T01004                                 

Gene name
acy3.1
Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) A
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    791456 (acy3.1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     791456 (acy3.1)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 791456
NCBI-ProteinID: NP_001138833
ZFIN: ZDB-GENE-040718-345
Ensembl: ENSDARG00000093003
Vega: OTTDARG00000019385
UniProt: Q6DHI0
Position
1
AA seq 328 aa
MTEEKAEEKNKMASVFLPALGGVAVCGGTHGNELSGVYLVQEMERQRKERGDGVWPIPVT
TVLSNPRAVKECRRYIDTDMNRCFSKAVLSTPITDSSPYEVRRAQELNNLLGVKGSDDVM
DMICDLHNTTSNMGLTLIHYSASDWVTLHICKYLQTKITKVPVRVLVLDFPINDAYNLES
VSKHGFTLEVGPQPQGVVRADIYVIMKEAVDLTIDWIHKFNSGTVFEGGDVEVFKFIKSV
DYPRDPETRNLTAAVHPQLQDRDFCLLKRGDPLFLSFSGETVTCEEEEPLHPFFINEGAY
YEKGIAFHLAKKWTLTVPSVQVQTTNSA
NT seq 987 nt   +upstreamnt  +downstreamnt
atgactgaagaaaaggctgaggagaaaaacaagatggcgtctgtgttcctgccagctctg
ggtggtgtggctgtttgtggcggcactcatggaaatgagctgtcgggtgtgtacctggtg
caggagatggagcgacagaggaaggagaggggagacggtgtgtggccgattcctgtaaca
actgtactgtcaaacccacgggctgtgaaggagtgcagaagatatattgatacagatatg
aaccgctgctttagcaaagctgtgctgagtactcctattacagacagcagcccatatgaa
gtccgacgtgctcaggaactgaataatcttctaggagtgaagggatctgacgatgtaatg
gacatgatttgtgacctccacaacaccacgtctaatatgggtctcacactcatccattac
tcagctagtgactgggtaaccctgcacatctgcaaatacttacagactaagataaccaaa
gtgcctgtgagagtgctggtactggatttccccattaatgatgcatataacttggagtcg
gtctccaagcatggctttactctagaggtcgggccgcagccacagggtgttgtcagagct
gacatctacgttattatgaaggaggctgtcgacttgactatagactggattcataagttc
aactcagggacagtatttgaaggtggagatgtggaagtcttcaagtttatcaaaagtgtg
gattatcccagagatcctgagacacgaaatctcaccgctgctgttcatcctcagcttcag
gatagagatttctgtctcctgaagaggggtgaccctttgtttttgtcattttctggagaa
acagtgacatgcgaggaagaagagccacttcatccgttctttatcaatgagggtgcctac
tatgaaaagggaatcgcttttcatctggccaaaaaatggacactgacagttccatcagta
caagtgcagacaacaaactcagcatga

DBGET integrated database retrieval system