KEGG   Danio rerio (zebrafish): 791647
Entry
791647            CDS       T01004                                 

Gene name
pnp5a
Definition
(RefSeq) purine nucleoside phosphorylase 5a
  KO
K03783  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre00240  Pyrimidine metabolism
dre00760  Nicotinate and nicotinamide metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    791647 (pnp5a)
   00240 Pyrimidine metabolism
    791647 (pnp5a)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    791647 (pnp5a)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     791647 (pnp5a)
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-GeneID: 791647
NCBI-ProteinID: NP_998476
ZFIN: ZDB-GENE-040426-2553
Ensembl: ENSDARG00000078619
Vega: OTTDARG00000035558
UniProt: Q6NYG0
Position
7
AA seq 293 aa
MFPESNTGYSFEDCQATADWLLSQTAVRPLVGIVCGSGLGGLADALKDQVAFNYRDIPNF
PQSTVHGHAGRLVFGTLKGRPCVCMQGRFHLYEGYPIQKITMPMRIFKMLGVETVILTNA
AGGLNQDYKVGDIMIIKDHLNMPGFAGNNPLAGHNDERFGVRFPCMSDAYDRELQQMALD
VGSELGFSDFLREGVYCVLGGPSFETIAECRMLHKLGADAVGMSTVHEVIVARHCGMRVF
ALSLITNKAVMDYDSEEKANHEEVLQTGKQRAEQLERLVSTIITRLEHNNNYA
NT seq 882 nt   +upstreamnt  +downstreamnt
atgtttcccgagagcaacactgggtacagtttcgaggattgccaggccaccgctgattgg
ctcctgtcccagactgcagtgcgccctctggtgggcatcgtgtgtggttcgggtttgggt
ggattggctgatgctctgaaagaccaggtggccttcaactaccgggacattcctaacttt
ccccagagtacagttcacggtcatgcgggtcggctggtgtttggcactttaaagggcagg
ccgtgtgtctgcatgcagggacgctttcatctctatgaaggatatcccatccagaagatt
acgatgccgatgcggattttcaagatgctgggtgtggagacggtgattcttaccaacgct
gctggcggtctgaaccaggactataaagtaggagacatcatgatcatcaaagaccacctc
aacatgcccggattcgctggaaacaaccctctggcgggacacaacgacgaaaggtttgga
gtgcgtttcccctgcatgtctgacgcgtatgatcgagagctgcagcagatggctctggat
gtgggatcagagctgggcttcagtgatttcctgcgggagggggtttactgtgttcttgga
ggaccgtcattcgagaccatcgctgagtgccgcatgctgcacaaactgggtgctgacgct
gtcggcatgagcacagttcatgaggtgatcgtagcccgtcactgcgggatgcgcgtcttc
gctctgtctttgataaccaataaagcagttatggattacgacagcgaggaaaaagccaac
catgaggaggtcctgcagacgggcaaacagcgagcggagcagctggagagactggtgtct
actattattacccggctggagcacaacaacaactacgcctaa

DBGET integrated database retrieval system