KEGG   Danio rerio (zebrafish): 791696
Entry
791696            CDS       T01004                                 

Gene name
asic1a
Definition
(RefSeq) acid-sensing ion channel 1A
  KO
K04829  acid-sensing ion channel 1
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    791696 (asic1a)
Ion channels [BR:dre04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   791696 (asic1a)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 791696
NCBI-ProteinID: NP_999955
ZFIN: ZDB-GENE-040513-2
Ensembl: ENSDARG00000008329
Vega: OTTDARG00000020075
UniProt: Q708S7 B0R1B0
Position
8
AA seq 501 aa
MKTSVMDLKVEPMDIDFDQPPPLQVFAHTSTLHGISHIFSYEKITAKCCLWVVFFLSSLT
FLMYVCIDRIQFYLEYPHVTKLDEITTPVMVFPAVTICNLNSIRFSRITRNDLYHAGELL
ALLNSRHEVREAHLVEESVMEVLKSKTDFRSFKPRHFNMWEFYNRTGHDIKDMLLSCQFR
GSPCRPEDFSVVFTRYGKCYTFNSGETGPPRVSVKGGMGNGLEIMLDIQQDEYLPVWGES
DESSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLVYLPAPWGSCKSTPPS
SDYFRAYSISACRTDCETRYLVENCNCRMVHMPGDAPYCTPVLYKECAHPALDFLVETDS
DYCSCETPCNITRYSKELSFVKIPSKASVKYLAKKYSKSEKYITENVMVLDVFFEALNYE
TIEQRKAYEVAGLLGDIGGQMGLFIGASILTILELFDYLYEVMKYRLCRCSNKKHHNNNN
NTDHNAVFSLDDVNCHVSKFH
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaagacatcagtgatggatcttaaagtggaaccaatggacattgatttcgaccagcct
ccgcctctccaagtgttcgctcacacctcaactctacacggcatctctcacatcttctcc
tatgagaagatcacggctaaatgctgcctctgggtggtgtttttcctcagctctttgact
tttctcatgtacgtctgcattgatcgcattcagttctacctggaatatcctcatgtcacc
aagctggatgagatcaccacgccggtgatggtgtttccggctgtgaccatttgcaatctg
aactccattcgcttcagcaggatcacgcgcaacgacctgtaccatgcaggagagctgctg
gcgctgctcaactccaggcatgaagttcgagaagctcacctggttgaagaaagcgtgatg
gaggttctcaagagcaaaaccgactttcgctcttttaagccgcgacatttcaacatgtgg
gagttttacaacagaacaggacacgacattaaagacatgctgctctcctgccagttcaga
ggctcaccatgccgtcctgaagacttcagtgtggtgttcacacgttatggaaagtgttac
acctttaactctggtgagaccggcccgccgcgggtcagcgttaagggcggtatggggaac
ggcctggagatcatgctggacattcagcaggatgaatatttacctgtttggggagagtca
gacgagtcttcatttgaagcaggaattaaagtccagattcacagtcaggacgagcctccg
tttatagatcagctgggcttcggagtcgctccaggattccagacgtttgtttcctgccaa
gagcagcgactggtgtatctgcctgcgccatgggggagctgtaaatccacaccgccgagc
tccgattatttcagagcatacagcatcagcgcctgccgaaccgactgcgagactcgatat
ctggtggagaactgcaactgccgcatggtgcacatgcctggtgatgcaccgtactgcacc
cctgtgctttacaaagaatgtgcacatccagcacttgatttcctggtggaaactgacagc
gactactgctcgtgcgagactccgtgcaacatcacacgctacagtaaagagctgtccttt
gtcaagatccccagcaaagcctccgtcaaataccttgccaaaaagtacagcaagtccgag
aaatacataactgagaatgttatggtgctggatgtgtttttcgaggctctgaactatgaa
accatcgagcagaggaaagcctatgaggtggctggtctgttaggggatattggaggacaa
atggggcttttcattggagccagtattcttaccattctggaactgtttgactacctttac
gaggtcatgaagtacaggttgtgccgctgctccaacaagaaacatcacaacaacaacaac
aacacggatcacaacgctgtattcagcctggatgatgttaattgtcacgtcagtaaattc
cattaa

DBGET integrated database retrieval system