KEGG   Danio rerio (zebrafish): 792197
Entry
792197            CDS       T01004                                 

Gene name
bgnb
Definition
(RefSeq) biglycan b precursor
  KO
K08118  biglycan
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:dre00535]
    792197 (bgnb)
Proteoglycans [BR:dre00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    792197 (bgnb)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_9 LRR_5
Other DBs
NCBI-GeneID: 792197
NCBI-ProteinID: NP_001001825
ZFIN: ZDB-GENE-040426-21
Ensembl: ENSDARG00000002945
Vega: OTTDARG00000021906
UniProt: B7ZDB5
Position
23
AA seq 374 aa
MSVMFSCRSLLLLLLSVCSLTAPSMALPFEQRGFWDFAMDGEAGDSTTVMMRDEEGSASE
ELPPDVFICPFGCHCQVNIVQCSDLSLIAVPKEIPRDTKLLDLQNNCITELKENDFKGLT
NLYALSLVNNKISKVHPRVFTPLRHLKKLYFSHNLLTVVPKNLPPSLVELRIHDNRIKKV
AEGTFSGLGSMNCIEMGGNPIQNSGFEPGAFKGLKLNYLRVSEAKLTGIPKDLPDSLHEL
HLDNNQIQAIELEDLRRYKHLYRLGLGFNQIRMIENGSLSYVSNLRELHLENNRLTRVPK
GLPDMKYLQVAYLHSNNISQVDVNDFCPQGFGMKRNFYHGISLYGNPVNYWEVQPATFRC
VADRLAIQFGNYKK
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcagtgatgttctcctgccgctctctcctgctgctgctactcagtgtctgcagcctc
actgctccctcaatggctctgccctttgagcagagaggattctgggactttgcaatggac
ggagaagcaggagattcgacaacagtaatgatgagagatgaagagggttcagcttcggag
gaactgccaccagatgtgtttatatgtccctttggatgccattgtcaagtcaacatagtg
caatgttcagacctaagtttaatcgcagtgcccaaggagattcccagagacaccaaactc
ctggacctacagaacaactgcatcacagaactgaaggagaacgacttcaaagggctcaca
aacctctacgccctgtcactggtcaacaacaagatctccaaagtccacccacgagtcttc
acacccctccgacatctgaaaaagctttatttttcccataacctcctgacagtggtaccc
aaaaaccttcccccatctctggtggagctgcgcattcatgacaaccgtattaagaaggtt
gcagaaggaacgttttctggtctgggcagcatgaactgcattgagatgggcggaaaccct
attcagaacagtggctttgagcctggcgcttttaaaggcctgaaactcaactacctgcgc
gtctctgaggccaaactcactggaataccgaaagatctccctgacagtcttcatgagctc
cacttggacaacaaccagatccaagccattgaactggaggacttgagacgctacaaacac
ctgtacagattgggtctgggtttcaaccagatccgcatgattgagaatggcagcctatca
tacgtctctaatctgagggagttgcatttggaaaacaaccgtctgacccgcgtcccgaag
ggcctgccagacatgaagtacctgcaggtggcttaccttcattccaacaacatcagtcaa
gtggatgtcaatgacttctgccctcaaggttttggcatgaaaaggaacttctaccatggc
atcagcctctacggaaacccggtgaactattgggaagtgcagcctgccaccttccgctgt
gttgctgaccgactggccattcagtttggaaactataaaaaatag

DBGET integrated database retrieval system