KEGG   Danio rerio (zebrafish): 792506Help
Entry
792506            CDS       T01004                                 

Gene name
zgc:172315
Definition
(RefSeq) uncharacterized protein LOC792506 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00040  Pentose and glucuronate interconversions
dre00053  Ascorbate and aldarate metabolism
dre00140  Steroid hormone biosynthesis
dre00830  Retinol metabolism
dre00860  Porphyrin and chlorophyll metabolism
dre00980  Metabolism of xenobiotics by cytochrome P450
dre00982  Drug metabolism - cytochrome P450
dre00983  Drug metabolism - other enzymes
dre01100  Metabolic pathways
Module
dre_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    792506 (zgc:172315)
   00053 Ascorbate and aldarate metabolism
    792506 (zgc:172315)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    792506 (zgc:172315)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    792506 (zgc:172315)
   00860 Porphyrin and chlorophyll metabolism
    792506 (zgc:172315)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    792506 (zgc:172315)
   00982 Drug metabolism - cytochrome P450
    792506 (zgc:172315)
   00983 Drug metabolism - other enzymes
    792506 (zgc:172315)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     792506 (zgc:172315)
Glycosyltransferases [BR:dre01003]
 Others
  Hydrophobic molecule
   792506 (zgc:172315)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_transf_5 Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 792506
NCBI-ProteinID: NP_001107098
ZFIN: ZDB-GENE-080220-7
Ensembl: ENSDARG00000091624
Vega: OTTDARG00000042713
UniProt: A8WGC1
Position
5
AA seq 527 aa AA seqDB search
MRPLACFLSLLSLLSAGECGNVLVWFTEGSHWINMKIVLETLIDRGHDVTVLVPDASLFM
KANASDRFSYQPFNVSMDEQEMKVFIEEFLYFSLYEMDQLNFFQMQSKVYEFTSKLQDMS
ISYCDGVLKSPGLLDKLRKHKFDVVFSDPIYQCSDIVAEELNVPLVYTFRFSLAHAAERM
CGQIPAPPSYVPGAMSKLTDRMSFTERIYNMLFYLSQDAFAVFAWKKIDNYYTEYFGRPT
SYCEMMGRADIWLIRTYWDFEFPRPFVPNFKYIGGLHCTPAKPLPKDMEEFVQSSGDDGI
VVFTLGSLVGKVPKEISNRIASALAQIPQKVLWRYGGEKPDTLGENTRIYKWIPQNDLLG
HPKTRAFITHGGTNGIYEAIYHGVPMVGIPLFGDQPDNMVHMTTRGAAVVVDSIKSMQPQ
ELVDKLNTVINDPSYKENAMRLSRIHHDRPMKPLDESVFWIEFVMRNKGAKHLRVEAHNL
TWYQYHCLDVFAFLTTVLTLVLYICFKMAKFFIMRCCFRSKRKSKKE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagaccgttggcgtgttttctttctcttctctctctcctcagcgctggagaatgtggg
aatgttttggtttggtttactgagggcagccactggattaatatgaagattgtgttggaa
acgctgatcgacaggggacacgatgtgacggtgctggttcccgatgcttctctcttcatg
aaagccaacgcatcggatcgcttctcctaccagccctttaacgtgtccatggatgaacag
gagatgaaagtcttcatcgaggagtttctgtatttttcactgtatgaaatggaccagctg
aactttttccagatgcaatcaaaagtctacgagttcacctccaaacttcaggacatgtcc
atttcatactgtgacggcgtcctgaagtctccagggttgctggataaattgaggaaacac
aagtttgatgttgttttttctgatccgatttatcagtgtagtgatattgtggctgaggag
ctgaatgttcccttggtttacactttccggttttcccttgctcatgcagcagagcgcatg
tgtggtcagataccagctccaccatcatatgttcctggagccatgagtaaactcacagac
aggatgagctttactgagcgaatctacaatatgctcttctacctttcccaagatgctttt
gctgtttttgcctggaaaaaaattgacaactattacactgaatattttggacggcccact
tcctattgtgagatgatgggtagagccgatatctggttaatcagaacctactgggatttt
gagtttccacggccattcgtgcccaacttcaaatatatcggagggcttcactgcacccct
gccaagccattacccaaggacatggaggagtttgtgcagagctcaggggatgatgggatt
gtggtcttcacactgggctctttggtaggcaaagtacccaaagagatcagcaacagaatc
gcctcagcactggcacagataccacagaaggtcctgtggcgatatggtggagagaaaccc
gatactcttggtgaaaacactagaatctataagtggatccctcagaatgatttattgggt
caccccaaaaccagagcattcatcactcacgggggcactaatggcatatatgaggccata
tatcacggtgtcccgatggtcggcatccccttgtttggtgaccagcctgataatatggtt
catatgaccaccagaggtgctgctgttgtagtagacagcattaagagcatgcagccacaa
gaactggtggacaaactcaatacagtcattaatgacccttcgtataaagagaatgcaatg
cgtttgtccaggattcatcacgacagaccaatgaagcctttagatgagtctgtgttctgg
attgagttcgtcatgcgcaataaaggtgcaaaacacctgcgtgtggaggcccacaacctg
acctggtatcagtaccactgtctggatgtgttcgcttttcttaccactgtcctgactcta
gtcctctacatctgctttaagatggccaaatttttcatcatgcgctgctgctttagatca
aagaggaaaagcaagaaagagtga

DBGET integrated database retrieval system