KEGG   Danio rerio (zebrafish): 792532Help
Entry
792532            CDS       T01004                                 

Gene name
cfap298
Definition
(RefSeq) cilia- and flagella-associated protein 298
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2870
Motif
Other DBs
NCBI-GeneID: 792532
NCBI-ProteinID: NP_956382
ZFIN: ZDB-GENE-040930-8
Ensembl: ENSDARG00000035332
Vega: OTTDARG00000019698
UniProt: Q6DRC3 B7ZVU8
Position
10
AA seq 290 aa AA seqDB search
MVQLHVKRGDESQFLFNTTVDVQIETLTQQICEIYNARLKVDRICSEIPELADHGISLPP
NMQGLTDDQIVELKLKDEWEERCIPSGGAEFKKDEIGRRNGHAPNEKMKDVLRRTMEEAK
ALISKKQLQANVCVTMEMVKEALDQLRGAVMIVYPMGLPPHDPIRMEIENQEDLTGTQAS
LQVITNEEAQLWWASKELHRGKKLQDYIGKNEKTKIIVKIQKRGQGAPAREPVVSEDEQK
QMMLHYYKRQEELKKLEEADDDTHLQSEWSDRQALKRQFQGLTNIKWGPR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggttcagctgcacgtcaaacggggagacgagagccagtttctcttcaacactacggtg
gatgtgcagattgagacgctgacccagcagatctgcgagatctacaatgcaagactaaaa
gtggacagaatctgctctgaaatcccagagctggcagatcatggtatctctttaccacca
aatatgcaaggcctgaccgatgatcagattgtggagctcaaactgaaggatgaatgggaa
gagcggtgcattcccagtggcggtgccgagtttaaaaaagatgagatcggacgtcgaaat
ggacacgccccaaacgagaaaatgaaagatgttttgcgaagaacaatggaggaagccaag
gctttaatttcaaaaaaacaacttcaagcaaatgtctgtgtcaccatggaaatggtgaaa
gaagctctggaccagctgagaggagctgtgatgatagtttacccaatgggacttcctcca
catgatccaataagaatggagattgaaaatcaggaagatctcactggaacacaggcctca
ttacaggtgatcaccaatgaagaggctcagctgtggtgggcatctaaagaactgcacagg
ggcaaaaagctgcaggattatattgggaaaaacgagaaaaccaaaattattgtgaaaatt
caaaaacggggccagggcgcacctgccagagaaccagtagtgagtgaagatgagcaaaag
cagatgatgctgcactattacaagagacaggaagaactgaaaaagctagaagaagcagat
gatgacacacatcttcagtcggagtggtcggacagacaggccctaaagaggcaatttcaa
ggacttacaaatatcaaatggggcccaagatag

DBGET integrated database retrieval system