KEGG   Danio rerio (zebrafish): 793549
Entry
793549            CDS       T01004                                 

Gene name
si:ch211-266d19.4
Definition
(RefSeq) zinc finger protein 271 isoform X1
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-met zf-Di19 zf-C2HE zf-C2H2_11 Zn-ribbon_8 zf-H2C2_5
Other DBs
NCBI-GeneID: 793549
NCBI-ProteinID: XP_001333332
ZFIN: ZDB-GENE-091204-74
Ensembl: ENSDARG00000012642
Vega: OTTDARG00000031692
UniProt: A0A2R8QGS5
Position
24
AA seq 1089 aa
MDPNQMDGIPSAGLNIRDEQMSGLETDSQDVQPSDASFDLGENADELNKSLSATVKPFQC
SQCGKGFSRIQHLSEHVRIHTGERPFQCLECGKTFARERDLKTHQLVHTDAKAFHCVICV
KNFALLSSLKRHLRAFHQGEDVSTEGKCLICVECGKNFDCDLEEHELTHTGEISHRCPDC
VNSFSDPSNLTSHDQTFSESDHVHHLEDNDNERPCGSLASEDVDRHLQTDPLNDCGEAQS
VEFADNIESDGFNESSAQIQLEEAERAASPSSEHSLDSAQKDTGPGYAPPDEEFTADQQS
SDEEKPYQCNHCEKRFNKQAKLRIHLRVHTGEKPYQCSQCGKHFSQDVNLKKHYRTHHTE
EKPYQCMICDRKFSVSFSLIKHQRVAHPECLSVAERKRFTCPFCGKIFGRHQDMEQHKRT
HTDERPFRCNVCNKSFRQRSVLIVHRKIHTGEKPFECFVCCRRFYGSGDLKTHMGTHTGI
RPHSCPLCSKSFPRPSSLQAHMLSHVNKQQDRNDGGFPQEEELEDACGASGSSAMLSEDK
TSNQSETGMDLSLSANQDHDANPSSSSELPDHQKPYFCIICGKTFALATSLRKHQLIFHP
DQHVDVEGKCFACSYCGRKFGRRQGLLQHERIHTGERPFNCPTCNKSFRQRSALVVHIRS
HTGERAFVCFVCNKSFYTPGDLKKHLEIHTGVRPHNCPICSKGFGRPSFLRTHMRTHEKT
SAKKQSGSENAAGKPKASSQEKPFECSHCGKKFSQQCMFKIHQRIHTTEKRYKCTECGLS
FRWRRNLISHQSTHPGQNPLQCSMCDQTFISEAAVKSHQDTFHSGVSHTCSLCLKTFTKS
AGLRKHVRYVHEGERPHKCTECNRGFVKVSDLARHQRRHHYDRGNQLFQCSECERSFSHP
SSLVLHRRTHTEEKHQCPQCDKIFNQAGHLKVHMRTHTKEIKPKFECPDCGKSFGQTKDL
MVHQRVHTGEKPYQCPQCKKSYRQFAHLSVHLRSHTGEKPYQCPICLKFFAHSSSMKKHL
RVMHPDAKDAPVGAGPSNTSVEVKQEPVSSDEDEFQVKSEENDFAIMDEVKTVTVSSCPS
SPMTLKEEK
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggacccgaatcaaatggatgggattccctcagctggccttaatattagagatgagcag
atgtctggtttagagacagactcccaggatgtacagccatccgatgcttcatttgatctg
ggggaaaatgcagatgagctcaataagagtttgtctgccaccgtgaagccgtttcagtgc
tctcagtgtgggaagggtttttcccgaatccagcatctgtccgaacacgtccgcatccac
accggcgagaggcctttccaatgcctggagtgtggaaagacgttcgcgcgtgagcgagac
ctcaagactcatcagctcgtccatactgatgccaaggccttccattgtgtgatctgtgtt
aagaactttgccctgttatcctccttgaaaagacatctgcgtgcatttcatcaaggtgaa
gatgtgagtacggagggaaagtgcttaatctgtgtcgaatgtgggaagaattttgactgc
gatctggaggagcacgagctgacacacaccggagagatttcccaccgctgtcccgactgc
gtcaacagcttttcagatccatccaatctcacgtctcacgatcagaccttctctgaatca
gaccacgtccaccatttggaagataatgacaatgagagaccctgcggttctctggcctct
gaagatgtagaccgacacttacaaaccgacccactaaatgactgcggtgaagcgcagtct
gtggagtttgctgacaatattgagagcgacggatttaatgaaagcagtgctcaaattcaa
ctggaggaggctgaaagagctgcgtctccatcatccgagcactctctggattctgctcaa
aaggacactggaccagggtacgctcctccagatgaagagtttacagctgaccagcagtcc
tctgatgaagaaaagccataccagtgcaatcactgtgaaaagagatttaacaagcaagcc
aagctccggatccatctgcgtgtccacaccggagagaagccgtaccagtgctctcagtgt
gggaaacacttcagtcaagatgtaaacctgaagaagcattaccgcacgcatcatacggag
gagaagccgtatcagtgcatgatctgtgaccgcaagttttcagtctccttctccctgata
aagcatcagcgtgtcgctcatccagagtgtttgagtgttgcagaaaggaagcgcttcacc
tgtccgttctgcggaaaaatattcggacggcatcaagacatggagcaacacaagcgcact
cacaccgacgagaggccgttccgctgcaatgtgtgcaacaaaagcttcaggcagcgctcg
gtgttaatcgtgcacaggaagatccacactggagaaaagcccttcgaatgcttcgtctgc
tgcagacgcttctacggctcgggagatctgaagactcatatgggcacgcataccggcatc
aggccacacagctgccctctgtgctcgaagagcttccctcgacccagcagcctgcaggca
cacatgctgtcccacgtgaacaagcagcaggacagaaatgatgggggttttcctcaggag
gaggagctggaggatgcctgcggggcttctggatcatcggccatgctttctgaagacaaa
acgagcaaccaatcagagacggggatggacttgagtctctcagcgaatcaagaccatgat
gccaatcccagctccagttcagagctgccagatcatcagaagccatatttttgcatcata
tgtggcaaaaccttcgctctcgccacttccctgagaaaacatcagctcatatttcatcca
gatcagcacgtggatgtggaggggaaatgtttcgcctgctcttactgcgggaggaagttt
ggtcgacgccagggtttattacaacacgagcgcattcacaccggagaaagacccttcaac
tgccccacctgcaacaaaagcttccggcagcgctcggctctggtggtgcacataagatca
cacacaggagagcgtgcgttcgtctgctttgtgtgcaataagagcttttacaccccagga
gacttaaagaagcatcttgaaatacacacaggagtgaggccacacaactgccccatctgc
tctaagggtttcgggcgtcccagtttcctacgcactcacatgcggacccatgaaaaaacc
tccgcaaagaagcaaagtggatctgagaacgcagcaggaaaaccaaaagcgtcctctcaa
gaaaagccgtttgagtgcagtcattgtgggaagaaattcagtcagcagtgcatgtttaaa
atccaccagcggattcacaccactgaaaagcggtataaatgcaccgagtgcggccttagc
tttcgctggaggaggaacctgatctcacaccagagcacccacccgggacaaaaccctctc
cagtgttcaatgtgcgatcaaacgttcatctctgaggctgctgtaaagagccaccaagat
acatttcactctggggtctcccacacatgcagtttgtgtctgaagacattcactaagtcg
gcaggtctccggaaacacgtgcgttacgttcacgaaggagagcgccctcacaaatgcacc
gagtgtaacagaggattcgttaaagtgtcggatctggcgcgtcatcagcgccgccatcat
tacgaccgcggaaaccaactcttccagtgctcggagtgtgaacgcagcttcagccacccc
agcagtctggtcctacaccggcgcacacacaccgaagagaaacaccagtgtcctcagtgc
gacaagatcttcaaccaggcggggcacctgaaggtccacatgcgcacacacaccaaggag
atcaaacccaagttcgagtgtcctgattgcgggaagagtttcggacagacgaaggatctg
atggtgcatcagagggtccacactggagaaaagccataccagtgtccgcaatgcaagaag
agctacaggcagtttgcgcatctgtctgttcatctgcgcagtcacacgggggaaaagccc
taccagtgtcccatatgcctcaagttcttcgcccattcgtcctccatgaagaaacacctg
cgtgtaatgcatccagatgcgaaggacgctcctgttggcgccggtccgtcaaacacaagt
gtggaagtcaaacaggagccagtgtcttctgatgaagatgaatttcaagtgaaatctgaa
gaaaacgactttgctataatggatgaggtgaagactgttacggtctcctcgtgtccgtcc
agtcctatgactctaaaagaggaaaaataa

DBGET integrated database retrieval system