KEGG   Danio rerio (zebrafish): 79381
Entry
79381             CDS       T01004                                 

Gene name
gstp1
Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00480  Glutathione metabolism
dre00980  Metabolism of xenobiotics by cytochrome P450
dre00982  Drug metabolism - cytochrome P450
dre00983  Drug metabolism - other enzymes
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    79381 (gstp1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    79381 (gstp1)
   00982 Drug metabolism - cytochrome P450
    79381 (gstp1)
   00983 Drug metabolism - other enzymes
    79381 (gstp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    79381 (gstp1)
Enzymes [BR:dre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     79381 (gstp1)
Transporters [BR:dre02000]
 Other transporters
  Pores ion channels [TC:1]
   79381 (gstp1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 Glutaredoxin2_C
Other DBs
NCBI-GeneID: 79381
NCBI-ProteinID: NP_571809
ZFIN: ZDB-GENE-020806-4
Ensembl: ENSDARG00000104068
Vega: OTTDARG00000042063
UniProt: Q9DDU5
Position
14
AA seq 208 aa
MAPYTLTYFAVKGRCGALKIMLADKDQQLKENLVTFEEWMKGDLKATCVFGQLPKFEDGD
LVLFQSNAMLRHLGRKHAAYGKNDSEASLIDVMNDGVEDLRLKYIKLIYQEYETGKEAFI
KDLPNHLKCFENVLAKNKTGFLVGDQISFADYNLFDLLLNLKVLSPSCLDSFPSLKSFVD
KISARPKVKALLECENFKKLPINGNGKQ
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctccctacacactcacatacttcgcagtcaaaggcagatgtggtgctttgaagatc
atgctggcggacaaagaccagcagctgaaggagaacctggtgacctttgaagagtggatg
aagggcgacttgaaagccacctgtgtctttgggcagttgcctaaatttgaagatggtgac
ctggtgctgtttcagtccaacgccatgctgagacatctgggtcgaaaacatgctgcatat
ggcaaaaacgacagtgaggcttccctcattgacgtgatgaacgacggcgttgaagatctt
cgcctgaagtacataaagctgatctaccaggaatatgagaccggtaaagaagcgttcatc
aaagatctgcccaaccacctcaaatgctttgaaaatgttctggccaaaaacaaaaccgga
ttcctggttggtgatcagatctcatttgcagactacaacctgttcgatctcctgctgaat
ctgaaggtgctttctccctcctgtctggactctttcccgtctctcaagagcttcgtggac
aagatctctgcccgtcccaaagtcaaagctctgctggagtgcgagaacttcaagaaactg
cccatcaacggcaacggcaaacagtaa

DBGET integrated database retrieval system