KEGG   Danio rerio (zebrafish): 793850
Entry
793850            CDS       T01004                                 

Gene name
si:ch211-284e13.5
Definition
(RefSeq) uncharacterized protein LOC793850
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 GAGA Zn_ribbon_SprT zf-met
Other DBs
NCBI-GeneID: 793850
NCBI-ProteinID: NP_001313506
ZFIN: ZDB-GENE-060526-162
Ensembl: ENSDARG00000094725
Vega: OTTDARG00000019022
UniProt: F1R7V0
Position
5
AA seq 392 aa
MEVNGGPANSTVTSEVSLSFQEELTATLQNALGVAVEIAVVEITRLLDRALREVQGQIQE
ALRDNSALKFRLQTAETQLSSVCGGLDLQTQSLEDFPVSNSSSSGGGQLMPPPLSRAQRG
GLQVSAVNIRQQTQSSVNSEQDYLLCEPKDTTVFQRVPMCGNPLAESALNSDSLGEATHY
HHGANDTKNEQHGMTKADLSCAGEVSHVLSDPSSLEVAIKVEKEESYGDPIPVSISVAEE
PNSDSLSLAQSRLLEDWRPEQLQSESCHTNMPCQSANHPVDFLSLSGSGQQIHFPKLNNR
KRPDHFMFPGGRGPYHCIICGRDFNRKHHLKIHQRIHTGERPYTCSICSARFRHALTLKR
HFRLHTGEKPYTCGQCGKKFRNDGGLRSHQCS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggaggtaaacggcggtcctgcgaactccacagtgacttcagaggtgtcattgtcgttt
caagaggaactaaccgcgaccctgcaaaacgcgctcggtgtggcggtggagatcgccgtt
gtggagatcaccagactgctggacagagccctccgagaggtgcagggacagattcaggag
gctctgcgggacaacagcgcgctcaagtttagactgcaaaccgctgaaacgcaactctcc
tcagtgtgcggtggcctggacctgcagacgcagagcctcgaggatttccccgtcagtaac
agcagcagcagcggcggcggtcagctgatgcctcctcctctcagcagagctcagcgcggc
gggctccaggtcagtgctgttaacatccggcaacaaacccagtccagtgtgaactcggaa
caagattatttgctgtgtgaaccaaaggacaccactgttttccagcgagtaccgatgtgc
gggaacccactcgcagaatcggctttaaactctgactcactaggggaagcgacccactat
caccacggggcaaatgacaccaagaatgagcagcacggtatgaccaaagctgacctgtca
tgtgctggagaagtttcgcatgtgctgagtgatccgtcgtcccttgaagtggctataaag
gtggagaaagaggagagttatggtgacccaatccctgtgtccatctctgtagcagaagag
ccaaactcagacagtctttctctggctcaatcgcgactgctggaagactggagacctgag
caattgcaatcagagagctgccatacaaacatgccttgccagtctgccaaccaccctgtt
gatttcctgtcattgtcaggctcgggccagcaaatccactttccaaagctcaacaatcgc
aagaggcccgatcactttatgtttcccggaggccgaggaccgtaccattgtatcatatgt
ggacgagacttcaaccgcaagcaccatctgaagattcatcagaggatccatacaggagag
aggccgtacacatgctccatctgcagcgcacgcttccggcatgctttgactcttaagcgt
cacttccgcctccatacaggagagaaaccttatacttgcggtcagtgtgggaaaaagttt
cgaaatgatggtggattgcggtcgcatcagtgttcatga

DBGET integrated database retrieval system