KEGG   Danio rerio (zebrafish): 794479Help
Entry
794479            CDS       T01004                                 

Gene name
col8a2
Definition
(RefSeq) collagen alpha-2(VIII) chain precursor
  KO
K23455  collagen, type VIII, alpha
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    794479 (col8a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C1q BclA_C
Motif
Other DBs
NCBI-GeneID: 794479
NCBI-ProteinID: NP_001076370
ZFIN: ZDB-GENE-060503-488
Ensembl: ENSDARG00000060893
Vega: OTTDARG00000015714
UniProt: Q1LUA9
Position
19
AA seq 686 aa AA seqDB search
MLTVLCVLLTLGNHALGGGYAPMPQMKYVQPMMKGPVGPPFREGKGQYLDFPPMTGITGE
PGPQGKPGPRGPAGPPGLPGKPGIGKPGLNGQTGPQGPSGLPGIGKPGLPGLPGKIGPKG
LPGLNGEVGPRGEPGPRGLQGQPGAPGPVGISLNGKPGLPGTRGPPGSRGEPGSKGARGV
PGEPGLKGENGNGHTGLTGPRGPTGLQGPPGAPGVPGLGKPGINGLPGPLGPKGDKGAPG
DQGPSGQVGPPGQQGPPGAPGLGKPGLDGIPGNLGPIGPKGEAGPRGTPGFPGPPGYGKP
GLVGQKGDRGPTGLQGVPGDKGEPGLEGLPGDLGPTGQSGLPGPQGLMGLPGKPGMPGLK
GENGPQGPSGLPGLRGDQGPSGLAGKPGLPGDKGLPGLNGATGKPGPKGEPGHIGLPGNP
GLIGAPGPKGENGFSGTPGPRGNSGIPGLPGPTGHMGPQGIPGLKGEQGPPGPQGIGKPG
DKGMPGPQGPPGKQGNPGLSGVQGPPGPPGPPGPPGPSNGDLNQLAVQGPNIAGESVPKP
NVERPNFGHAELSVSVAPAFTAILTTPFPPSAMPIKFDRTLYNGQNAYNPATGIFTSPLS
GVYYFAYHVHVKGTSLWVALYKNNVPATYTYDEYKKGYMDQASGSAVLELKENDQVWVQM
PSDQANGLYSTEYIHSSFSGFLLCPT
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggtgctctgtgtcctgctaaccctggggaatcatgcccttggtggaggttac
gctcctatgcctcagatgaagtacgtgcagcccatgatgaaggggcctgttgggcctccc
ttcagagaaggcaagggccagtatctcgattttccaccgatgacgggcataacaggggag
ccaggtccccaagggaagccaggaccaaggggaccagctggtccccctggattacctgga
aaaccaggtataggaaagcctggtctcaatggtcagactggtccacaaggaccttcagga
ttacctgggattggtaaaccaggtctaccaggtttaccaggaaaaatagggcctaaagga
ctgccaggacttaatggcgaggttgggcctcgtggagagccaggcccacggggacttcaa
ggtcaaccaggagcgcctgggcctgtaggtatttcattgaatggtaaaccagggttacct
ggcactagaggcccgccaggatcaagaggtgagccggggagtaaaggtgcacgtggtgtt
ccaggtgaaccaggacttaaaggggaaaatggcaatggacacacaggtctaacaggtccc
aggggacccactggccttcaaggacctccaggagctcctggtgtccctggattgggtaaa
ccagggattaatggcctgcctgggccattggggccaaagggtgataaaggagcaccagga
gatcaaggaccctctggacaagttggtcctccgggacaacaagggccaccaggagcacct
ggtttgggaaaacctggacttgatggtattccaggaaacttgggcccaataggcccaaag
ggggaagctggccccagaggaactcctggatttccaggaccccctggctatggaaaacca
ggacttgtagggcagaaaggagacagaggtcctactggattacaaggagtccctggggat
aaaggagaacctggactggaaggtctaccaggagatttagggccaactggacagtctggg
cttccaggtccacaaggtttaatgggtcttccaggaaaacctgggatgccaggtcttaaa
ggagagaatggaccacaaggaccttcaggtttgccaggacttagaggagatcagggcccg
agtgggctggcaggaaagcctggcctcccaggagataaaggtctacctggtcttaacgga
gccactggcaaacctggacctaaaggtgaaccaggtcacatcggtctgccaggcaatcct
ggtttaattggagcaccagggccaaaaggtgagaacgggttttcaggaacccctggacca
cgtggcaattcagggattcctggactcccaggccctactggtcatatgggacctcaaggc
attccaggattgaaaggcgaacaaggaccaccagggccacaaggaattggaaagcctgga
gacaaggggatgcctggtccacagggacctccaggaaaacaaggcaatcctggactcagc
ggtgtacagggccccccgggtccacctggacctcctgggccccctggcccctctaacggt
gatttaaatcagttagcagttcaaggtccaaatatcgcaggagaatctgttccgaaacca
aatgttgaaaggccaaactttggtcatgccgagctctctgtctccgtggctcctgctttt
actgcaattttgacaaccccatttccaccatctgcaatgccaatcaaatttgacagaact
ctttacaatgggcaaaatgcttacaaccctgccacaggcattttcacaagcccactgtct
ggagtctactactttgcttatcatgtacacgtaaagggaaccagtctgtgggtggcactg
tataaaaacaatgtgcctgccacatacacctatgatgaatacaagaagggttatatggac
caggcttcaggtagtgcagtgctggagctgaaggagaatgaccaggtttgggtgcaaatg
ccctctgaccaggcaaatgggctctactccactgagtacatccattcgtccttctcaggg
ttcctcctgtgtcccacataa

DBGET integrated database retrieval system