KEGG   Danio rerio (zebrafish): 794666Help
Entry
794666            CDS       T01004                                 

Gene name
itpr3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04020  Calcium signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04114  Oocyte meiosis
dre04210  Apoptosis
dre04218  Cellular senescence
dre04270  Vascular smooth muscle contraction
dre04371  Apelin signaling pathway
dre04540  Gap junction
dre04621  NOD-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    794666 (itpr3)
   04020 Calcium signaling pathway
    794666 (itpr3)
   04070 Phosphatidylinositol signaling system
    794666 (itpr3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    794666 (itpr3)
   04210 Apoptosis
    794666 (itpr3)
   04218 Cellular senescence
    794666 (itpr3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    794666 (itpr3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    794666 (itpr3)
   04625 C-type lectin receptor signaling pathway
    794666 (itpr3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    794666 (itpr3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    794666 (itpr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    794666 (itpr3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    794666 (itpr3)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     794666 (itpr3)
Ion channels [BR:dre04040]
 Ligand-gated channels
  IP3 receptor
   794666 (itpr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec MIR RYDR_ITPR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 794666
NCBI-ProteinID: NP_001300740
ZFIN: ZDB-GENE-070605-1
Ensembl: ENSDARG00000061741
Vega: OTTDARG00000026569
UniProt: A0A0R4IH08
Position
8
AA seq 2634 aa AA seqDB search
MSDSASSFLHIGDIVSLYAEGTVNGFISTLGLVDDRCVVEPASGDLENPPKKFRDCLFKV
YPMNRYSAQKQFWKAKQAKHEKDKIGDMVLLQKLQHAANLEQKQNDAENKKVHGDVVKYG
SVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWLFIQPFWKLRANGDNVVV
GDKVILNPVNAGQPLHASSYELPDHSGCKEINSVNSNTSWKISLFMMFSDHKDEVLKGGD
VVRLFHAEQEKFLTCDEYKSKLHVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGH
WNSLYRFKHLATGNYLAAEENPGYKENSNDIEVDSSRIKRSLGERIKYKLVAVPHGNDIA
SLFELDPTTLQKTDSFVPRNSYVRFRHLCTNTWIQSTNIPIDIDEERPIRLMLGTCPTKE
DKEAFAIVSVPVMEIRDLDFANDASLMLSTVVEKFKYGFLSPNDRRYAIKLLEDVVFFVV
DQLNNGQPALEVSMNKPNRERQKLMREQNILKQIFGIIKAPFKERGDDPPLLTLEELSDQ
KYLLYQYMLRLCYRVLRHSQEDYRKNQEYIAKQFGMMQSQIGYDILAEDTITALLHNNRK
LLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNNVAIPVTQELICKCVLNAKNQDI
LMKTERRAAKESQHTSEYLEEFGDEDEVWLIWSEKENENHEKSIRQLAQEARQGNVHDEN
VLTYYRYQLKLFARMCFDRQYLAIDVISKQLDIELISLCMMDETLPFDLRASFCRLMLHA
HVDRDPQELVTPIKFARLWTEIPTSISIKDYDSHLDYSRDNKKNKFANTMAFMEEYLNNV
LIDDLPFANEEKNKLTYEVVSLARHLIYFGFYSFFELLRLTRTLLGIIDCTPSNASINPL
FNDDGSGKNVRRSIHGMGQMMSTMVLNRKPSLFSAPGRTGDSQVGSKDSIDTQDITVMDT
KLKILEILQFILSVRLDYRLSFLLSVFKKEFVDVYPMEDADATHHTEHEASINLQHIGEQ
AEAMFGIGKGNSILEVDDEGGRMFLRVLIHLIMHDYPPLVSGALQLLFKHFSQRQEVLHT
FKQVQLLISTQDVDNYKHIKRDLDLLRTMVEKSELWVIKKSSSGGDGKKDKKDKKEPEAV
SPEEEADSKKQTTEKSNESYQNVKEILERLNKMCSSGVFKKQQRLLKNMGAHKVMLDLLQ
ISYDRNDTKMLEIIKYTHLFLQKFCTGNLENQALLHKHLNLFLTPRLLEAETMQQIFSNN
FQLCSEISESVLHHFIHCLATQGRHIQYLNFLHTIIKAEGKYVKKCQDMIMTELTSAGDD
VVVLYTDDTSFNTMVELMTQSREGVKDDSPLRYHISLVELLAACAEGKNVYTEIKCTSLL
PLEEMVKVITHEDCITEVKIAYVNFVNHCYVDTEVEMKEIYTSNHIWKLFENFTVDMARV
CSNREKRMSDPVLEKYVIQVVLDTVTAFFSSPFSENSTSTEAHHTTVKQLLQSTMRLLDC
PWLQPQQKVQVESCIRTLAVTTKSRSIPLPVELEAHVNMMLSHSNSLTLSRSSHSNKSMS
RLTRPAAPTNPWDYKNIIEKLQDIINTLEERVMPLVNAELSVLVDVLHQPELLFLEGTDA
RSRCESGGFISKLIQHTKALMNSDEKLCIKVLRTLQEMLIRELDFDEKGFALRKVLLQNY
LYNNKKNIKAELVEHAGGAEGERDWLTVAALQCRLDKEGGTKLFTDLITSTKNEKIFQES
IQLAICLLEGGNTEIQNSFYKLMMGDNKSEKFFKVLNDRMKNAQLDIKSTVSVNVGEMSN
KAKDDKDLETGGVSSFGQPEPQPEQQEVETEMGPSVTIMKPILRFLQLLCENHNQDLQNF
LRIQNNKTNYNLVSETLQFLDIMCGSTTGGLGLLGLYINENNVELITQTLETLTEYCQGP
CQENQTCIVSHECNGIDIITALILNDISPLCRYRMELVLQLKDNASKLLLALMESRHDSE
NAERILFNLRPRELVELIKKAYLQEGECKEGEVSPREVGHNIYILALQLARHNKVLLTLL
KPVKKIKEEEEESISSMLNLNKQQEEEKEDPLEHYDRQTAQIEIVREDRSMEQIVFPVHP
ICEFLTEESKFRVFTTTEQDEQGSKVTNFFEQTSFLHNEMEWQKKLRSMPVLYWFSRRMS
LWGTISFNLAVFINLIIALFYPHDSGHSGSIDSSLLLMGFWCFAGLAVLGLLFKRYGFQS
LTVAITLRCIYHFGIGPTLLLLGALNLINKIVYLVSFVGNNGTFIMGYKAMVMDVEFLYH
VAYVLTSSLGLFVHEFFYSILLFDLIYREETLFNVIKSVTRNGRSILLTAVLAIILVYLF
SIVGFLFLRNDFIMEVDHLASPAPGDTESFMSSCSSDGIDCTEETGLLAPAEDEDNTERA
CDTLLMCIITVLNHGLRNGGGVGDVLRKPSKNEPLFPARVVYDLLFYFIVIIIVLNLIFG
VIIDTFADLRSEKQKKEEVLKTTCFICGLERDKFDNKTVSFEEHIKLEHNIWNYLYFIVL
IREKNKTDYTGPESYVALMIKNKNLDWFPRMQAMSLVVTDGDGEQNEMRNLQDRLSSTMK
VVTQLTSQLTELKEQMTEQRKRRQRMGFVDVQSGSNPGMPVPPSPAGGNQVYKA
NT seq 7905 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattcggcgtctagttttctccatatcggggatattgtgtccctgtatgcagaa
ggaactgtcaatggttttataagcacactggggctggtggatgaccgttgtgtcgtggag
cctgcaagtggagatttagaaaaccctcccaaaaaattcagagactgcctctttaaggtg
tatcccatgaacagatattcggctcagaaacagttctggaaagccaaacaggccaaacat
gaaaaggataaaattggagacatggtgcttcttcagaaattgcagcatgcagctaatttg
gaacaaaagcagaatgatgctgagaacaaaaaggtccacggcgatgtggttaaatacggc
agcgtcattcagctgctccacatgaagagtaacaagtatttgacagtaaataagcgtctc
ccagcactactggagaagaatgcaatgcgcgtcactctggatgggacggggaatgagggc
tcctggcttttcattcagcctttctggaagctcagagccaacggagacaatgtggtggtt
ggagacaaagtgatcctgaatcctgtgaatgctggacagcctctccatgccagcagctat
gagcttcccgatcattcagggtgcaaagagatcaactctgtgaacagcaacaccagctgg
aagatcagtctgtttatgatgttcagtgaccacaaagatgaagtgctgaaaggaggagac
gtggtgaggctgtttcacgctgaacaggagaagtttctgacctgtgatgagtacaagtct
aaactgcacgtgttcttgcgcacaactctgcgtcagtcagctacttcagccaccagctct
aatgcattatgggaagtggaggtggtccaccatgatccatgtcgaggaggagccggacac
tggaacagcctctacagattcaaacacctggccacaggaaactatctcgctgctgaggag
aacccaggttacaaagaaaacagcaatgatattgaggtggacagcagtcgtatcaagaga
agccttggagaaaggattaaatataagctagtcgcagtgcctcatgggaacgacatcgcc
tctctgtttgagctggacccgacaacactgcagaagactgattcatttgtgccaagaaat
tcttatgttcgatttcgccacctgtgcacgaacacttggatccaaagcaccaacattcct
atcgacatcgatgaagagcggccgattcgattaatgctgggcacgtgccccactaaagag
gacaaagaagcattcgccatcgtctctgtgccggtcatggagattcgagatctagacttc
gccaatgatgcgagtctcatgttgagcactgttgtcgagaagttcaaatacggttttctc
agtcctaatgacagaaggtatgccattaagctgctggaggatgtggtattctttgttgtg
gatcaacttaacaatggccagccggccctggaggtgtcgatgaacaagcccaaccgagag
agacagaaactgatgagagagcagaacattttaaaacagatatttgggatcattaaagct
ccgttcaaagagaggggagatgatcctcctctactgacactggaggaactgtccgaccag
aaatacttattgtatcagtacatgctcaggctgtgctacagggtgctgcgtcattcacag
gaagactaccgaaagaatcaggagtacatagctaagcagtttggaatgatgcagtctcag
atcggctatgatattctggcggaggacaccatcacagccctgctccacaacaaccgcaaa
ctgctagagaaacacatcactaaaactgaggtggagacatttgtcagtctggttcgcaaa
aacagggaacccaggtttctagactatctttcagacttgtgtgtgtccaataatgtagca
atcccagttactcaagagctgatctgtaaatgcgtgctgaacgccaagaaccaggatatt
ctcatgaaaacagagcggcgagcagctaaggaaagtcagcacacttccgagtacttggaa
gagtttggagacgaggatgaagtttggctgatctggtctgaaaaggaaaatgagaaccat
gaaaagagcattcggcagcttgcccaagaggcccgtcaagggaacgtgcatgatgaaaat
gttctgacatattacaggtaccagctgaagctgttcgcacgaatgtgttttgatcggcag
tatctggccatagatgtgatctcaaagcagctggatatagagctaatctcgctctgcatg
atggacgagactcttccctttgacctgcgagcgtctttctgtaggctcatgctgcacgca
cacgttgatcgtgaccctcaggagcttgtgacgcccatcaagtttgcccgcttgtggact
gagattcccacctctatcagcatcaaagattatgactctcacttggactattcacgagac
aataaaaagaacaagtttgctaataccatggctttcatggaggaatacctcaacaatgtg
ctcatcgatgacctgccttttgcaaacgaggagaaaaacaagctaacgtatgaggtggtg
agcttggcgaggcatctcatctactttggcttctacagctttttcgagctcctgagattg
actcgcactcttctgggaatcatagactgcactccgagcaacgcttccatcaacccactg
ttcaacgatgatggcagtggtaagaacgtcaggcgctccattcatggcatgggacagatg
atgtctaccatggtgcttaaccgaaaaccatctctgttctccgctcctggtcgaactgga
gacagtcaagtcggcagtaaagacagcatcgacacacaagacatcactgtcatggacacc
aaactcaagattctggagattttacagttcatcctcagcgttcgtctagactatcggctt
tcgttcctcctctccgtcttcaagaaggagtttgtggatgtttatcctatggaagatgca
gatgccacacatcatactgagcatgaggcttccatcaacctacagcacattggagagcag
gcagaggccatgtttggaattggtaaaggaaacagcattctggaagtggatgatgaagga
ggacgaatgtttctgcgtgttttgatccacctcatcatgcacgactaccctccattggtt
tctggggccttgcagttgctgttcaagcacttcagtcaaagacaagaagtccttcatact
tttaaacaggtccaattgcttatttcaactcaggatgtggacaactataaacacataaaa
cgagatctggatctgctgcgcaccatggtggagaagtctgagctttgggtcattaaaaag
agcagttctgggggagatggaaagaaagacaagaaagacaaaaaagagcctgaagcggtg
tcacctgaggaggaggctgattctaagaaacagacaactgaaaaaagcaatgaaagctac
cagaatgttaaagagattctagagcgattgaataaaatgtgcagttcaggtgtatttaag
aagcaacaaaggctactgaagaacatgggtgcgcacaaagttatgctggacctgttgcag
atctcctatgatcggaatgacaccaaaatgctggagatcatcaagtacacacatctgttt
ctgcaaaagttctgcacagggaatctggagaaccaggctctcctccataaacacctcaac
cttttcctgacacctaggctcctggaggcagaaacaatgcagcagattttcagcaataat
ttccagctctgttctgagatcagcgagtctgtgctgcatcatttcatacattgcctggcc
acacaaggccggcacattcagtacctcaactttctgcacaccatcattaaggccgaaggg
aaatatgtgaagaaatgccaagacatgatcatgactgagcttactagtgcgggggatgat
gtggtcgtcctctacacggatgacacgtcgtttaacaccatggtggagctgatgacccag
tcgagggaaggggtgaaggacgacagcccgctgcgctaccatatctctctggtggagctg
ctggctgcatgtgctgaggggaaaaacgtctacactgagatcaagtgcacatctctgctg
cccctagaggaaatggtcaaagtaatcacacatgaagactgcataactgaggtgaaaatt
gcttatgtgaactttgtgaaccactgctatgtggacacagaagtggagatgaaggagatc
tacaccagcaaccacatctggaagctttttgagaacttcactgtagatatggccagagtg
tgctccaaccgtgagaaacgcatgtcagaccctgtgctggagaagtatgtaattcaggtc
gttttagacactgtaactgccttcttcagctctcctttctctgagaacagcaccagcacg
gaggctcatcacaccactgtaaagcagctgctgcagtccaccatgcgtctgttagactgt
ccatggctacagccacagcaaaaagtccaagtggagtcctgcatccgaacactagcagtg
acaaccaagagtcgctctattcctctgccagtggagttggaggctcatgtcaacatgatg
ttgagtcacagtaattccctcacattgtcccgatccagtcactccaacaaaagcatgtca
cgcttaacacggcctgccgctcccaccaacccctgggactacaagaacatcattgaaaaa
ctacaggatatcattaacacactggaggagcgtgtgatgcctttggtgaatgcggagctg
tctgtgctggtggatgtgctgcatcagcctgagctgctgtttctggaaggcaccgatgct
cgctcacgctgtgaatcaggaggatttatttctaaattgatccagcacacaaaggccctc
atgaactccgatgagaagctctgtatcaaagtcctcagaactctgcaggaaatgctcatt
cgcgagttggatttcgatgaaaagggctttgccttaagaaaggtgttgctccagaactac
ctctacaataacaaaaagaacataaaagcagagcttgttgaacacgcaggaggtgcagag
ggcgagagagactggctaacagtggcagcattacagtgtcgcctggacaaagaaggcggc
accaaactcttcacagacctcatcaccagcaccaagaatgagaagatcttccaggagagc
attcagctcgctatctgtctgctagaagggggaaacacagagatccagaactccttctac
aaactcatgatgggagacaacaagtctgagaagttttttaaagtgctgaatgaccgcatg
aagaacgcacagcttgacatcaaatccaccgtctctgtcaatgtgggggaaatgagcaac
aaagccaaagatgacaaagatctggagactggtggcgtatcgtcgtttggccagcctgag
cctcaacctgaacaacaggaagtggaaacagaaatggggccatctgtcaccatcatgaaa
cccatcctgcgctttctacagctgctctgtgagaaccacaatcaggaccttcagaacttt
cttcgcattcagaacaacaaaacaaactataacctggtgtcagagactctgcagtttctg
gacatcatgtgcggcagcacaactggaggactgggtctgctgggcctttacatcaatgag
aacaatgtggagctgatcacacagaccctggagaccctcacagagtactgtcaggggcca
tgccaagagaaccagacatgcattgtctcccatgagtgcaacggtattgacatcatcaca
gctttaattctgaatgacatcagtcctttatgtcgatatcgcatggaactggtgcttcag
ctcaaggacaatgcctctaagcttcttctggctctgatggagagccgtcatgacagtgag
aatgcagagaggatcctgtttaatcttcgacccagagaactggtggagctgattaaaaag
gcttatctgcaagagggtgagtgtaaggagggagaagtgtcaccacgagaagttgggcat
aacatctacatcctggcactacagcttgcccgacacaacaaagtgctactcacactgctt
aaaccagtaaagaagataaaagaggaagaagaggaaagcatctcctctatgctcaatctg
aacaagcagcaggaggaggaaaaggaggatccactagagcactacgaccgtcaaactgct
cagattgagattgttcgtgaagatcgcagcatggagcagattgtgtttcctgttcaccct
atctgtgagtttcttacggaggagtcaaagtttcgagtgttcaccaccacggagcaggac
gagcagggcagcaaagtcacaaacttcttcgagcagacctccttcctccacaacgagatg
gaatggcagaaaaagcttcgcagcatgccggtgctgtactggttctctcgcagaatgtct
ctctggggcaccatatctttcaacctggctgttttcatcaatcttatcatcgctttgttt
taccctcatgactctggtcattctggtagcatcgactcttctcttctgctcatgggattc
tggtgttttgctggactggctgttttaggcctgctattcaagcgatatgggtttcagtca
ctgaccgttgccatcacgctgcgctgcatctatcacttcggtattggtccgacactcctc
ttgctgggggctctcaatctcatcaataagatagtgtacttggtgagctttgtgggaaac
aacggcaccttcatcatgggttataaagccatggtaatggatgtagaattcctgtatcat
gtggcttacgtgttaaccagcagtctggggctgtttgtccatgagttcttctacagcata
ttgctgtttgatctgatctaccgtgaggagacactgtttaacgtcatcaagagtgtgacc
cgtaacggccgctctattctcctcactgctgtcctggccatcattctggtctacctgttc
tccatcgtcggctttctcttcctcaggaatgacttcattatggaagtcgaccaccttgct
agcccagctccaggagatactgaaagctttatgagcagctgcagttctgatggaattgac
tgcacagaggaaactggtctccttgctccagctgaagatgaagacaacactgagagagca
tgtgacacccttcttatgtgtattattacggtgctgaatcatgggctgaggaatggagga
ggtgtaggagatgttctgcgcaaaccatctaagaatgagcctttgtttcccgctcgtgtg
gtgtatgaccttctcttctactttattgtcatcatcattgttctcaacttgatttttggt
gtgattattgacaccttcgctgacctgcgtagtgaaaaacagaagaaagaagaagttctg
aagaccacctgtttcatttgtggtcttgagagggacaagtttgacaataagacagtgtca
ttcgaggaacatattaaattggagcacaacatctggaactacctctattttattgtgctg
atacgggagaaaaacaagaccgattacaccggcccggagagctatgtggctcttatgata
aagaataagaacctggattggtttccacgcatgcaggccatgtctctggttgtaacggat
ggagatggagaacaaaatgagatgaggaacctgcaggatcgtcttagctccaccatgaaa
gtggtcacacagctcacaagccagttaacagagctgaaagaacagatgactgagcagagg
aagaggagacagcggatgggttttgtggatgttcagtccggctccaaccctgggatgcct
gtgcctcctagtcctgctggaggaaatcaggtctacaaggcctaa

DBGET integrated database retrieval system