KEGG   Danio rerio (zebrafish): 795372Help
Entry
795372            CDS       T01004                                 

Gene name
si:dkeyp-118h3.5
Definition
(RefSeq) probable G-protein coupled receptor 45
  KO
K08409  G protein-coupled receptor 45
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    795372 (si:dkeyp-118h3.5)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    795372 (si:dkeyp-118h3.5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 795372
NCBI-ProteinID: XP_005167494
ZFIN: ZDB-GENE-070912-629
Ensembl: ENSDARG00000063357
Vega: OTTDARG00000025484
UniProt: B0S7I8
Position
9
AA seq 375 aa AA seqDB search
MFACNGSSLEACGLLEPTETEMQEADTALMPTTLRVALAAIMIFMITIGFLGNGIVCLIV
YQKPAMRSAINLLLATLAFSDIMLSLLCMPFTAVTLATTDWSFGMGFCRVSVMLYWLFVL
EGVSILLIISVDRFLIIVQRQDKLTPHRAKILIGASWALSLCVSLPSLVGWRTAGIGAQV
PQCILGYSESLADRGYTVLLAVAVFFVPFGVMLYSYLCILNTVRRNALRIHNHTSEGSVA
ISHVSKLGLTGLQRPQVNIDMSFKTRAFTTILILFIGFSVCWLPHTVVSLLSVFSRRFYL
SPAFYPVSIGALWLSYLKAVFNPVIYCWRIRKFREACLEFMPKTFHLCPKIPGRSRRRIR
PSNIYVCSSETQSSV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatgtaatggcagctcattggaggcatgcggccttctcgaaccaacggaaacc
gagatgcaagaggctgatactgccctcatgcccaccactctcagggtggcactggctgcc
ataatgatcttcatgatcaccataggtttccttggcaatggcattgtgtgtctaatagtg
tatcagaagcctgcaatgcgttcagctataaatctgctcttagccacactggcgttttct
gacatcatgctgtcactgctatgcatgccattcaccgccgtcactctcgcaactacggac
tggagctttggaatgggattctgtcgtgtttccgtcatgttatattggctgtttgttcta
gaaggggtgtctatccttctgatcatcagcgttgatcgattcctcattattgttcaacgg
caggacaagctgactccacatcgggcaaaaatcctcattggcgcatcatgggctctgtcg
ctttgcgtgtccctaccatctcttgttggttggaggacagcagggattggggcacaagtg
ccacagtgcattctgggatacagcgaatccctggcagaccggggttacacagtactgctt
gcagtcgctgtgttttttgtgccgtttggtgtgatgttgtattcatacctatgtattctc
aatacggttcgacggaatgctctgcgcatccacaatcacactagtgaaggcagcgttgca
atcagccatgtcagcaagttgggtttaaccggtttacagcggccccaagtcaacatagac
atgagtttcaaaacaagagccttcactaccatccttatccttttcattggcttctccgtg
tgctggttgccacacacagtggtgagtctgttgtcggtgttcagcagacgcttctacctc
agccctgcattttacccagtgagcatcggggctctttggttgagctacctaaaagcggtc
ttcaacccggtgatatactgctggagaatccgaaagtttcgagaggcctgtctggagttt
atgcccaagacctttcatctgtgtccaaagattccaggccgaagtcgcaggcgcataagg
cccagcaacatctatgtgtgcagcagcgagactcagtcttcagtctag

DBGET integrated database retrieval system