KEGG   Danio rerio (zebrafish): 796370Help
Entry
796370            CDS       T01004                                 

Gene name
edar
Definition
(RefSeq) tumor necrosis factor receptor superfamily member EDAR precursor
  KO
K05162  tumor necrosis factor receptor superfamily member EDAR
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    796370 (edar)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dre04050]
    796370 (edar)
Cytokine receptors [BR:dre04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   796370 (edar)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4501 TNFR_c6 SID-1_RNA_chan RIFIN
Motif
Other DBs
NCBI-GeneID: 796370
NCBI-ProteinID: NP_001108536
ZFIN: ZDB-GENE-070117-2062
Ensembl: ENSDARG00000099088
UniProt: A0A0R4IGE7
Position
9
AA seq 460 aa AA seqDB search
MGHKGGRTPSFLLHFLLVSSMSTVSAEYSSCGENEFYNHTTSSCQPCPQCQAGQEPYMNC
GYGTKDDDYSCVSCPAGKFSKGKYEICRRHKDCDALYRATVLTPGTSDSDAECGHCLPGY
YIQENRPQNIYGMVCHSCQNAPRNIKECMRSTPPASGRAPSVSSSSTTIFPQPEKDPTGQ
GHLATALIIAMSTIFIMAIAIVMIIMFYILKSKPSGPVCCSGQLIKAVEAQTNMQEEKKE
AQENVVIFQEKDEFDKLKPSSPKTAKSENDASSENEQLLSRSIDSDEEAAQDKQGAADLC
LLSLVHLTRDKSCTTNTINNNNNNHCSRATGIHSRRKKILDLYTKACSVAEGLSPTELPF
DCLERSSRMLSATYSTDKAVVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIPD
LLARLLQIERLDAVETLCCDILSGTQNCTNPPLSSRCASV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgggtcataaaggaggacggacgccatctttcctcctgcattttctgctggtgtccagc
atgtctacagtgagcgctgaatactcgagctgtggagaaaatgagttttacaatcacaca
accagcagctgccaaccctgcccacagtgccaagctggacaagagccgtacatgaactgt
ggttacggcactaaagacgatgattactcctgcgtttcctgtccggctggtaaattctcc
aaaggaaagtacgagatctgccgtcgacacaaagactgtgacgctctttaccgcgccact
gtcctgacgcccggcacctctgacagcgacgctgagtgcggacactgtttaccagggtac
tacatccaggagaaccggccgcagaacatctacggtatggtgtgtcattcatgccaaaac
gctcctcgaaacatcaaagagtgcatgaggtccacaccgccagcctcaggtcgagctccc
agtgtttcttccagcagcaccactatattccctcagccagagaaagacccaacaggacag
ggtcacctagcaacggccctcatcatcgccatgtcaaccatcttcatcatggccatcgct
atagtgatgatcatcatgttctacatcctgaagagcaaaccgagcggaccagtctgctgt
tctggtcagctcatcaaagctgtagaagctcagacaaacatgcaggaggagaagaaggag
gctcaggagaacgtggtgatctttcaggagaaggacgaatttgacaaactcaagccttca
tctccaaaaacagccaaaagtgagaatgacgcgtcatcagaaaacgagcagctgctgagt
cgcagtatcgacagtgatgaagaagcagcgcaggacaaacagggagctgcagatctttgt
cttctttcactggtgcatctgaccagagacaaatcctgcaccaccaacaccatcaacaac
aacaacaacaaccactgcagcagagccaccgggattcacagcagaaggaaaaagatcctg
gatttgtacacaaaagcctgcagtgttgcggaaggtctgagcccgacggagctgccgttc
gactgtctggagcgcagcagccggatgctcagcgccacctacagcacagataaagcggtg
gtgaagacgtggaggcacctggcggagagcttcgggctgaagagagacgagatcggcggc
atgacggacgggatgcagctgttcgaccgcatcagcaccgctggatacagcatccctgac
ctgctggcgcgcctgctgcagatcgagcggctggacgcggtggagacgctctgctgcgac
atcctgagcggaacacagaactgcactaatccgcccctgagctcccgctgcgccagcgtc
tga

DBGET integrated database retrieval system